Pages : 0 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 312 313 314 315 316 317 318 319 320 321 322 323 324 325 326 327 328 329 330 331 332 333 334 335 336 337 338 339 340 341 342 343 344 345 346 347 348 349 350 351 352 353 354 355 356 357 358 359 360 361 362 363 364 365 366 367 368 369 370 371 372 373 374 375 376 377 378 379 380 381 382 383 384 385 386 387 388 389 390 391 392 393 394 395 396 397 398 399 400 401 402 403 404 405 406 407 408 409 410 411 412 413 414 415 416 417 418 419 420 421 422 423 424 425 426 427 428 429 430 431 432 433 434 435 436 437 438 439 440 441 442 443 444 445 446 447 448 449 450 451 452 453 454 455 456 457 458 459 460 461 462 463 464 465 466 467 468 469 470 471 472 473 474 475 476 477 478 479 480 481 482 483 484 485 486 487 488 489 490 491 492 493 494 495 496 497 498 499 500 501 502 503 504 505 506 507 508 509 510 511 512 513 514 515 516 517 518 519 520 521 522 523 524 525 526 527 528 529 530 531 532 533 534 535 536 537 538 539 540 541 542 543 544 545 546 547 548 549 550 551 552 553 554 555 556 557 558 559 560 561 562 563 564 565 566 567 568 569 570 571 572 573 574 575 576 577 578 579 580 581 582 583 584 585 586 587 588 589 590 591 592 593 594 595 596 597 598 599 600 601 602 603 604 605 606 607 608 609 610 611 612 613 614 615 616 617 618 619 620 621 622 623 624 625 626 627 628 629 630 631 632 633 634 635 636 637 638 639 640 641 642 643 644 645 646 647 648 649 650 651 652 653 654 655 656 657 658 659 660 661 662 663 664 665 666 667 668 669 670 671 672 673 674 675 676 677 678 679 680 681 682 683 684 685 686 687 688 689 690 691 692 693 694 695 696 697 698 699 700 701 702 703 704 705 706 707 708 709 710 711 712 713 714 715 716 717 718 719 720 721 722 723 724 725 726 727 728 729 730 731 732 733 734 735 736 737 738 739 740 741 742 743 744 745 746 747 748 749 750 751 752 753 754 755 756 757 758 759 760 761 762 763 764 765 766 767 768 769 770 771 772 773 774 775 776 777 778 779 780 781 782 783 784 785 786 787 788 789 790 791 792 793 794 795 796 797 798 799 800 801 802 803 804 805 806 807 808 809 810 811 812 813 814 815 816 817 818 819 820 821 822 823 824 825 826 827 828 829 830 831 832 833 834 835 836 837 838 839 840 841 842 843 844 845 846 847 848 849 850 851 852 853 854 855 856 857 858 859 860 861 862 863 864 865 866 867 868 869 870 871 872 873 874 875 876 877 878 879 880 881 882 883 884 885 886 887 888 889 890 891 892 893 894 895 896 897 898 899 900 901 902 903 904 905 906 907 908 909 910 911 912 913 914 915 916 917 918 919 920 921 922 923 924 925 926 927 928 929 930 931 932 933 934 935 936 937 938 939 940 941 942 943 944 945 946 947 948 949 950 951 952 953 954 955 956 957 958 959 960 961 962 963 964 965 966 967 968 969 970 971 972 973 974 975 976 977 978 979 980 981 982 983 984 985 986 987 988 989 990 991 992 993 994 995 996 997 998 999 1000 1001 1002 1003 1004 1005 1006 1007 1008 1009 1010 1011 1012 1013 1014 1015 1016 1017 1018 1019 1020 1021 1022 1023 1024 1025 1026 1027 1028 1029 1030 1031 1032 1033 1034 1035 1036 1037 1038 1039 1040 1041 1042 1043 1044 1045 1046 1047 1048 1049 1050 1051 1052 1053 1054 1055 1056 1057 1058 1059 1060 1061 1062 1063 1064 1065 1066 1067 1068 1069 1070 1071 1072 1073 1074 1075 1076 1077 1078 1079 1080 1081 1082 1083 1084 1085 1086 1087 1088 1089 1090 1091 1092 1093 1094 1095 1096 1097 1098 1099 1100 1101 1102 1103 1104 1105 1106 1107 1108 1109 1110 1111 1112 1113 1114 1115 1116 1117 1118 1119 1120 1121 1122 1123 1124 1125 1126 1127 1128 1129 1130 1131 1132 1133 1134 1135 1136 1137 1138 1139 1140 1141 1142 1143 1144 1145 1146 1147 1148 1149 1150 1151 1152 1153 1154 1155 1156 1157 1158 1159 1160 1161 1162 1163 1164 1165 1166 1167 1168 1169 1170 1171 1172 1173 1174 1175 1176 1177 1178 1179 1180 1181 1182 1183 1184 1185 1186 1187 1188 1189 1190 1191 1192 1193 1194 1195 1196 1197 1198 1199 1200 1201 1202 1203 1204 1205 1206 1207 1208 1209 1210 1211 1212 1213 1214 1215 1216 1217 1218 1219 1220 1221 1222 1223 1224 1225 1226 1227 1228 1229 1230 1231 1232 1233 1234 1235 1236 1237 1238 1239 1240 1241 1242 1243 1244 1245 1246 1247 1248 1249 1250 1251 1252 1253 1254 1255 1256 1257 1258 1259 1260 1261 1262 1263 1264 1265 1266 1267 1268 1269 1270 1271 1272 1273 1274 1275 1276 1277 1278 1279 1280 1281 1282 1283 1284 1285 1286 1287 1288 1289 1290 1291 1292 1293 1294 1295 1296 1297 1298 1299 1300 1301 1302 1303 1304 1305 1306 1307 1308 1309 1310 1311 1312 1313 1314 1315 1316 1317 1318 1319 1320 1321 1322 1323 1324 1325 1326 1327 1328 1329 1330 1331 1332 1333 1334 1335 1336 1337 1338 1339 1340 1341 1342 1343 1344 1345 1346 1347 1348 1349 1350 1351 1352 1353 1354 1355 1356 1357 1358 1359 1360 1361 1362 1363 1364 1365 1366 1367 1368 1369 1370 1371 1372 1373 1374 1375 1376 1377 1378 1379 1380 1381 1382 1383 1384 1385 1386 1387 1388 1389 1390 1391 1392 1393 1394 1395 1396 1397 1398 1399 1400 1401 1402 1403 1404 1405 1406 1407 1408 1409 1410 1411 1412 1413 1414 1415 1416 1417 1418 1419 1420 1421 1422 1423 1424 1425 1426 1427 1428 1429 1430 1431 1432 1433 1434 1435 1436 1437 1438 1439 1440 1441 1442 1443 1444 1445 1446 1447 1448 1449 1450 1451 1452 1453 1454 1455 1456 1457 1458 1459 1460 1461 1462 1463 1464 1465 1466 1467 1468 1469 1470 1471 1472 1473 1474 1475 1476 1477 1478 1479 1480 1481 1482 1483 1484 1485 1486 1487 1488 1489 1490 1491 1492 1493 1494 1495 1496 1497 1498 1499 1500 1501 1502 1503 1504 1505 1506 1507 1508 1509 1510 1511 1512 1513 1514 1515 1516 1517 1518 1519 1520 1521 1522 1523 1524 1525 1526 1527 1528 1529 1530 1531 1532 1533 1534 1535 1536 1537 1538 1539 1540 1541 1542 1543 1544 1545 1546 1547 1548 1549 1550 1551 1552 1553 1554 1555 1556 1557 1558 1559 1560 1561 1562 1563 1564 1565 1566 1567 1568 1569 1570 1571 1572 1573 1574 1575 1576 1577 1578 1579 1580 1581 1582 1583 1584 1585 1586 1587 1588 1589 1590 1591 1592 1593 1594 1595 1596 1597 1598 1599 1600 1601 1602 1603 1604 1605 1606 1607 1608 1609 1610 1611 1612 1613 1614 1615 1616 1617 1618 1619 1620 1621 1622 1623 1624 1625 1626 1627 1628 1629 1630 1631 1632 1633 1634 1635 1636 1637 1638 1639 1640 1641 1642 1643 1644 1645 1646 1647 1648 1649 1650 1651 1652 1653 1654 1655 1656 1657 1658 1659 1660 1661 1662 1663 1664 1665 1666 1667 1668 1669 1670 1671 1672 1673 1674 1675 1676 1677 1678 1679 1680 1681 1682 1683 1684 1685 1686 1687 1688 1689 1690 1691 1692 1693 1694 1695 1696 1697 1698 1699 1700 1701 1702 1703 1704 1705 1706 1707 1708 1709 1710 1711 1712 1713 1714 1715 1716 1717 1718 1719 1720 1721 1722 1723 1724 1725 1726 1727 1728 1729 1730 1731 1732 1733 1734 1735 1736 1737 1738 1739 1740 1741 1742 1743 1744 1745 1746 1747 1748 1749 1750 1751 1752 1753 1754 1755 1756 1757 1758 1759 1760 1761 1762 1763 1764 1765 1766 1767 1768 1769 1770 1771 1772 1773 1774 1775 1776 1777 1778 1779 1780 1781 1782 1783 1784 1785 1786 1787 1788 1789 1790 1791 1792 1793 1794 1795 1796 1797 1798 1799 1800 1801 1802 1803 1804 1805 1806 1807 1808 1809 1810 1811 1812 1813 1814 1815 1816 1817 1818 1819 1820 1821 1822 1823 1824 1825 1826 1827 1828 1829 1830 1831 1832 1833 1834 1835 1836 1837 1838 1839 1840 1841 1842 1843 1844 1845 1846 1847 1848 1849 1850 1851 1852 1853 1854 1855 1856 1857 1858 1859 1860 1861 1862 1863 1864 1865 1866 1867 1868 1869 1870 1871 1872 1873 1874 1875 1876 1877 1878 1879 1880 1881 1882 1883 1884 1885 1886 1887 1888 1889 1890 1891 1892 1893 1894 1895 1896 1897 1898 1899 1900 1901 1902 1903 1904 1905 1906 1907 1908 1909 1910 1911 1912 1913 1914 1915 1916 1917 1918 1919 1920 1921 1922 1923 1924 1925 1926 1927 1928 1929 1930 1931 1932 1933 1934 1935 1936 1937 1938 1939 1940 1941 1942 1943 1944 1945 1946 1947 1948 1949 1950 1951 1952 1953 1954 1955 1956 1957 1958 1959 1960 1961 1962 1963 1964 1965 1966 1967 1968 1969 1970 1971 1972 1973 1974 1975 1976 1977 1978 1979 1980 1981 1982 1983 1984 1985 1986 1987 1988 1989 1990 1991 1992 1993 1994 1995 1996 1997 1998 1999 2000 2001 2002 2003 2004 2005 2006 2007 2008 2009 2010 2011 2012 2013 2014 2015 2016 2017 2018 2019 2020 2021 2022 2023 2024 2025 2026 2027 2028 2029 2030 2031 2032 2033 2034 2035 2036 2037 2038 2039 2040 2041 2042 2043 2044 2045 2046 2047 2048 2049 2050 2051 2052 2053 2054 2055 2056 2057 2058 2059 2060 2061 2062 2063 2064 2065 2066 2067 2068 2069 2070 2071 2072 2073 2074 2075 2076 2077 2078 2079 2080 2081 2082 2083 2084 2085 2086 2087 2088 2089 2090 2091 2092 2093 2094 2095 2096 2097 2098 2099 2100 2101 2102 2103 2104 2105 2106 2107 2108 2109 2110 2111 2112 2113 2114 2115 2116 2117 2118 2119 2120 2121 2122 2123 2124 2125 2126 2127 2128 2129 2130 2131 2132 2133 2134 2135 2136 2137 2138 2139 2140 2141 2142 2143 2144 2145 2146 2147 2148 2149 2150 2151 2152 2153 2154 2155 2156 2157 2158 2159 2160 2161 2162 2163 2164 2165 2166 2167 2168 2169 2170 2171 2172 2173 2174 2175 2176 2177 2178 2179 2180 2181 2182 2183 2184 2185 2186 2187 2188 2189 2190 2191 2192 2193 2194 2195 2196 2197 2198 2199 2200 2201 2202 2203 2204 2205 2206 2207 2208 2209 2210 2211 2212 2213 2214 2215 2216 2217 2218 2219 2220 2221 2222 2223 2224 2225 2226 2227 2228 2229 2230 2231 2232 2233 2234 2235 2236 2237 2238 2239 2240 2241 2242 2243 2244 2245 2246 2247 2248 2249 2250 2251 2252 2253 2254 2255 2256 2257 2258 2259 2260 2261 2262 2263 2264 2265 2266 2267 2268 2269 2270 2271 2272 2273 2274 2275 2276 2277 2278 2279 2280 2281 2282 2283 2284 2285 2286 2287 2288 2289 2290 2291 2292 2293 2294 2295 2296 2297 2298 2299 2300 2301 2302 2303 2304 2305 2306 2307 2308 2309 2310 2311 2312 2313 2314 2315 2316 2317 2318 2319 2320 2321 2322 2323 2324 2325 2326 2327 2328 2329 2330 2331 2332 2333 2334 2335 2336 2337 2338 2339 2340 2341 2342 2343 2344 2345 2346 2347 2348 2349 2350 2351 2352 2353 2354 2355 2356 2357 2358 2359 2360 2361 2362 2363 2364 2365 2366 2367 2368 2369 2370 2371 2372 2373 2374 2375 2376 2377 2378 2379 2380 2381 2382 2383 2384 2385 2386 2387 2388 2389 2390 2391 2392 2393 2394 2395 2396 2397 2398 2399 2400 2401 2402 2403 2404 2405 2406 2407 2408 2409 2410 2411 2412 2413 2414 2415 2416 2417 2418 2419 2420 2421 2422 2423 2424 2425 2426 2427 2428 2429 2430 2431 2432 2433 2434 2435 2436 2437 2438 2439 2440 2441 2442 2443 2444 2445 2446 2447 2448 2449 2450 2451 2452 2453 2454 2455 2456 2457 2458 2459 2460 2461 2462 2463 2464 2465 2466 2467 2468 2469 2470 2471 2472 2473 2474 2475 2476 2477 2478 2479 2480 2481 2482 2483 2484 2485 2486 2487 2488 2489 2490 2491 2492 2493 2494 2495 2496 2497 2498 2499 2500 2501 2502 2503 2504 2505 2506 2507 2508 2509 2510 2511 2512 2513 2514 2515 2516 2517 2518 2519 2520 2521 2522 2523 2524 2525 2526 2527 2528 2529 2530 2531 2532 2533 2534 2535 2536 2537 2538 2539 2540 2541 2542 2543 2544 2545 2546 2547 2548 2549 2550 2551 2552 2553 2554 2555 2556 2557 2558 2559 2560 2561 2562 2563 2564 2565 2566 2567 2568 2569 2570 2571 2572 2573 2574 2575 2576 2577 2578 2579 2580 2581 2582 2583 2584 2585 2586 2587 2588 2589 2590 2591 2592 2593 2594 2595 2596 2597 2598 2599 2600 2601 2602 2603 2604 2605 2606 2607 2608 2609 2610 2611 2612 2613 2614 2615 2616 2617 2618 2619 2620 2621 2622 2623 2624 2625 2626 2627 2628 2629 2630 2631 2632 2633 2634 2635 2636 2637 2638 2639 2640 2641 2642 2643 2644 2645 2646 2647 2648 2649 2650 2651 2652 2653 2654 2655 2656 2657 2658 2659 2660 2661 2662 2663 2664 2665 2666 2667 2668 2669 2670 2671 2672 2673 2674 2675 2676 2677 2678 2679 2680 2681 2682 2683 2684 2685 2686 2687 2688 2689 2690 2691 2692 2693 2694 2695 2696 2697 2698 2699 2700 2701 2702 2703 2704 2705 2706 2707 2708 2709 2710 2711 2712 2713 2714 2715 2716 2717 2718 2719 2720 2721 2722 2723 2724 2725 2726 2727 2728 2729 2730 2731 2732 2733 2734 2735 2736 2737 2738 2739 2740 2741 2742 2743 2744 2745 2746 2747 2748 2749 2750 2751 2752 2753 2754 2755 2756 2757 2758 2759 2760 2761 2762 2763 2764 2765 2766 2767 2768 2769 2770 2771 2772 2773 2774 2775 2776 2777 2778 2779 2780 2781 2782 2783 2784 2785 2786 2787 2788 2789 2790 2791 2792 2793 2794 2795 2796 2797 2798 2799 2800 2801 2802 2803 2804 2805 2806 2807 2808 2809 2810 2811 2812 2813 2814 2815 2816 2817 2818 2819 2820 2821 2822 2823 2824 2825 2826 2827 2828 2829 2830 2831 2832 2833 2834 2835 2836 2837 2838 2839 2840 2841 2842 2843 2844 2845 2846 2847 2848 2849 2850 2851 2852 2853 2854 2855 2856 2857 2858 2859 2860 2861 2862 2863 2864 2865 2866 2867 2868 2869 2870 2871 2872 2873 2874 2875 2876 2877 2878 2879 2880 2881 2882 2883 2884 2885 2886 2887 2888 2889 2890 2891 2892 2893 2894 2895 2896 2897 2898 2899 2900 2901 2902 2903 2904 2905 2906 2907 2908 2909 2910 2911 2912 2913 2914 2915 2916 2917 2918 2919 2920 2921 2922 2923 2924 2925 2926 2927 2928 2929 2930 2931 2932 2933 2934 2935 2936 2937 2938 2939 2940 2941 2942 2943 2944 2945 2946 2947 2948 2949 2950 2951 2952 2953 2954 2955 2956 2957 2958 2959 2960 2961 2962 2963 2964 2965 2966 2967 2968 2969 2970 2971 2972 2973 2974 2975 2976 2977 2978 2979 2980 2981 2982 2983 2984 2985 2986 2987 2988 2989 2990 2991 2992 2993 2994 2995 2996 2997 2998 2999 3000 3001 3002 3003 3004 3005 3006 3007 3008 3009 3010 3011 3012 3013 3014 3015 3016 3017 3018 3019 3020 3021 3022 3023 3024 3025 3026 3027 3028 3029 3030 3031 3032 3033 3034 3035 3036 3037 3038 3039 3040 3041 3042 3043 3044 3045 3046 3047 3048 3049 3050 3051 3052 3053 3054 3055 3056 3057 3058 3059 3060 3061 3062 3063 3064 3065 3066 3067

  1. Ferguson potato ridger 123350294570
  2. Metal signs Vintage style Cadburys Cocoa Cricket tin 222941603961
  3. Swarovski 2008 Violetta Lovlots Gang 323559171299
  4. The People vs Alex Cross Alex Cross 25 142703815262
  5. Women Knitwear Knitted Sweatshirt Warm Jumper Pullover Sweater 521924457242
  6. Adjustable Flash Shoe Umbrella Light Stand L shape Bracket 252246317001
  7. 3D Unicorn Emoji Rainbow Girls Backpack Rucksack School 153140201149
  8. 10 Port 10 100Mbps Fast LAN Ethernet Network Switch 202520939468
  9. Yamaha It250 K L 323595861853
  10. 10152025 disposable surgical dust virus flu protectors face 191924880488
  11. UK Womens Blouse Plunge Ladies Tee Sweatshirt Base 553292401543
  12. Button Corner embroidered baby blanket Christening 372037698369
  13. Tulip Stitch Markers 15 pkg yellow small white medium brown large 132862471471
  14. UnknownFemale Head16x12A3Poster 332728401381
  15. TC Scottish Great Highland Bagpipe Rosewood Black Color 530619256608
  16. Levis Men 511 Distressed Vintage Wash 30x30%E2%80%9D Blue 113109460825
  17. GERMANY BELGIUM OCC 1916 18 early surcharged 232612945403
  18. DJ Smurf Non Stop Booty Shake 2XLP 153302776047
  19. Fluffy Floam Slime Putty Scented Stress Relief No 431882241993
  20. Antique Vintage Cut Glass Scent Perfume Bottle 273618513702
  21. 10x 39mm 24V 6 SMD LED C5W 5050 Panel 292861006487
  22. high quality A Set of 6 Strings for 282241282614
  23. for stick cone water drip shape incense burner 202420184829
  24. Buddha Bar And The Soul Brothers Solstice 292885335853
  25. Sabian XSR 18in 20in Fast Crash Pack 352438728065
  26. Huge Pair Of Heavy Duty Double Cast Iron 282893382685
  27. Reusable Soft Baby Diapers Cloth Diaper Inserts 3 502276678258
  28. Brushed Polished Chrome Square Door Knob Handle Kitchen 292489814877
  29. HEAVY DUTY HEADREST MESH DOG GUARD FOR MAZDA 152863223643
  30. Bon Jovi Always Living In Sin 45 372548554362
  31. Beru GER014 0190005014 145 V Alternator Regulator 362384817416
  32. Dellorto 6 Mm Main Jet Jets Size 140 360721995800
  33. 48LED Solar Sensor Motion Powered Wall Light Exterior 323444063314
  34. BGA Sump Oil Pan SP2303 BRAND NEW 173248457010
  35. Heart Agate Jade Gem Pendant with Sterling Silver 581250047907
  36. Women Kids Autumn Winter Warm Double Fur 292746315861
  37. Disney Minnie Mickey Stitch Apple iPhone 4 5 541471654055
  38. View To A Kill 2015 REGION 1 DVD 131849281693
  39. Honda CR V MK3 2007 To 2009 6 Speed 312367446220
  40. Bret Hart Signed 16x12 Photo Display WWF Wrestling 273220784300
  41. Baby Boys Girls Spanish Style Large Bow Knitted 512385564590
  42. Jean Michel Jarre Equinoxe Box 132901152445
  43. Vauxhall Astra J 13 CDTI Mk6 2011 Indicator 192744259951
  44. Asus X451 X451CA X502CA TP550L TP550LD Laptop AC 312077252416
  45. DVD John Wayne BLOOD ALLEY Lauren Bacall Anita 223263226008
  46. A 5 x 3 inch white card Personally 401118719066
  47. 2 4 6 Pcs Wooden Dining Chairs with Backrest Wood 584175736874
  48. Pair Antique 18thC Chinese Qing Qianlong Blue 392188210622
  49. 4 12W E27 Antique Style Edison Vintage LED Light 492779641587
  50. Bronte Emily Jack Ian E Wuthering Heights US IMPORT 113342806995
  51. Bitmain Power Supply Antminer Bitcoin APW3 12V 163439430899
  52. Luxury KINYUED Mens Automatic Mechanical Wrist Watch Genuine 650974960040
  53. 250Ml 1L 5L Vitalink Buddy Flowering Bloom Booster additive enhancer 112615658925
  54. PC Micro USB Cable Male Host to USB 332133805429
  55. Hot Sale Wholesale Fashion Solid Silver Plated 8mm 400709577158
  56. Womens Winter Windproof Casual Baseball Cap Hat Fur 113294113766
  57. NEW Funny Infant Child Pacifier Orthodontic Nipples Dummy 413641906364
  58. Adobe Encore CS5 %E2%80%93 Professional Video Training 291867780392
  59. 10pcs set Crystal Faceted Resin Beads Silver Core Fit 263663638836
  60. Paw Patrol Racer Chase Everest Ryder Skye Character 441790113429
  61. uk Adjustable Festive Gold Christmas Ring Festive Animal 451058210370
  62. SONNY CHER All I Ever Need Is 223273879537
  63. Febi Wiper Motor VW Crosspolo 4 9N Polo 173629440844
  64. Travel Waterproof DSLR SLR Digital Camera Bag Backpack 123518612111
  65. High Quality Coloured C6 114x162mm Envelopes for A6 561971087677
  66. Waterproof Camouflage Dmp Canvas Fabric 150Cm Wide 441961899226
  67. Maitland Smith Double Pedestal Flame Mahogany Dining Table 92 323563012989
  68. Kinetic Rave Flyers Club Kinetic 1994 Vibealite Digital 254038094662
  69. Star Wars Attack Of The Clones Jedi Star 283318034341
  70. Die Hard Vivere o morire 2007 DVD ex 372351022864
  71. 2Pair Compression Socks Running Anti Fatigue Graduated Travel 423713277842
  72. TOGUARD Trail Game Camera 14MP Hunting Wildlife Camera 253565043011
  73. Genuine Toyota Prius Front LH Rubber Wiper 8521478010 223247155774
  74. LED Grow Light Full Spectrum T8 Fluorescent Tube 502101789575
  75. 375mm 49mm 375 49 Stepping Ring Filter Ring Adapter 253715013468
  76. DJ Roy Cure Pain Dancehall Mixtape Reggae 123445272218
  77. 10 x 15 cm Memo Photo Album for 492514203176
  78. Abyssinian Cat Crystal Round Keyring High Quality Crystal 323100222012
  79. Sekonda Christmas Set Rose Gold Bracelet Ladies Watch 352547522555
  80. Women Tassel Scarf Winter Autumn Thick Warm Shawl 432164476839
  81. Mikuni Vm38 Carb Needles And Jets Twinshock Evo 264097611063
  82. GB FIRST DAY COVER FDC 183078084779
  83. PROJECTOR LENS WILL WETZLAR MAGINON 128 202531873230
  84. Rare Antique Master Print CAROLUS LEONARDI PHYSICIAN Saenredam Van de Velde 1629 401438903979
  85. Real Techniques Finish Setting Brush 1413 BRAND 332853072126
  86. Full Set Ball End Opera Perlon Violin Strings 272258369821
  87. Pet Ting small medium Bird Bath White transparent 142913445980
  88. The David Attenborough Dvd Wildlife Collection Life On 283302924603
  89. Women Winter Half Finger Fingerless Gloves Wrist Arm Hand 591566414809
  90. Citroen C4 Grand Picasso Super White Xenon HID 291791834475
  91. Antique Art Deco 18ct Gold Sapphire Diamond 143037312185
  92. 2x 1 4 Inch to 3 8 1 4 3 8 183062895009
  93. Mercedes W176 A Class Diamond Grille Amg Sport 264003150468
  94. Irish RM Series 3 2 DVD Set 283099563086
  95. Vintage Mod Dandy wool style scarf geometric gold 283314651501
  96. Strictly Tango 192474751403
  97. mayfair volume 28 number 6 mens adult glamour 264041176943
  98. 9 Holes Lotus Incense Burner Holder Flower Statue 492587635490
  99. Kia Soul Luxury BLACK RED Trim 132028366257
  100. Ginger in the Morning 1974 8x10 Orig Movie 222734276461
  101. Food by Pienkowski Jan Hardback Book The Cheap 142560340531
  102. Portwest Iona Bib and Brace Comort Safety Chest 323233056100
  103. Aerobic Mini Stepper Leg Arm Cord Body Training 123352142305
  104. BMW R 1100 RT 1996 Sintered Motorcycle Rear 270934896238
  105. Sony PlayStation Vita Replacement Case and Cover Batman 573053065633
  106. Die Cast Hot Wheels Mattel 124 Scale Batman 202468771888
  107. Tv Action Countdown 79 19Th August 1972 132391885313
  108. VIZONTELE Movie New DVD Original New Sealed 312359996270
  109. 55 x 21mm Female to 55 x 17mm 362276075998
  110. BARBIE FASHIONISTAS No 32 DOLLED UP DENIM DOLL 283302741331
  111. VW golf mk4 Passat Octavia 223132265128
  112. 2010 Renault Megane 14 TCe Dynamique Tom Tom 143050364220
  113. Courage Under Fire Denzel Washington Meg Ryan 143028680219
  114. LG 34UC79G BAEU 34UC79G B 34 UltraWide Full HD LED 123333380052
  115. Screwless Flat Plate Matt Black Light Switches 541668777052
  116. BIRDS OF PREY VOLUME 2 GRAPHIC NOVEL New 291695257217
  117. Disney Frozen Bundle Job Lot Anna Doll Singing 123556963389
  118. 2015 65 Vauxhall Vivaro 2900 L2 Double Cab 113470877513
  119. A5 C5 Size Hard Back Cardboard Please Do 641082326263
  120. The History Channel Great Battles of Rome for 382623521838
  121. Walking Stick Crook Handles For Canes Making Available 490162781158
  122. Kung Fu Panda DVD Brand New and Sealed 233055413445
  123. Vintage Omega Speedmaster Nos 1171 Bracelet band Screw Links 192677001410
  124. MONROE 37311 Monroe OESpectrum Light Truck Shock Absorber 352540716887
  125. mens adidas originals adi ease trainers sneakers sizes 321840631385
  126. 2 LED White Daytime Running Lights Car Motorcycle 162884456090
  127. Leeds Rhinos Shirt By Patrick Signed 232805668825
  128. Matilda by Gallico Paul Paperback Book The Cheap 142928756539
  129. A FANTASTIC OLD HANDMADE AZERBAIJAN ORIENTAL KILIM 320 392060103258
  130. 9x Steering Servo Linkages Pull Rods for 1 12 323444646050
  131. UK Stock 5 x Convert GU10 to E27 162821512689
  132. ATT Telephone old school princess 163412969646
  133. Comline Lower Front Rear Wishbone Bush CRB3045 173300074219
  134. Peugeot Partner 850 S 90 Hdi 2010 292834610796
  135. 2018 SEAT LEON 10 TSI SE Dynamic EZ 192709399421
  136. Ford S Max 20 Duratorq TDCi Genuine Febi Engine 302003143515
  137. Bikkembergs Jersey Shirt T Shirt Stadium 665 L 362415333840
  138. H DUTY LEATHER LOOK SEAT COVER SET BLACK GREY For 222982259753
  139. PG 540XL CL 541XL High Capacity Ink Cartridge For 271851473185
  140. Vintage Mid Century Wooden Tea Pot Stand Trivet 153307312873
  141. Club Room NEW Orange Mens USA Medium M 143058603923
  142. Vw Polo 9N 2004 Fabia Ibiza 14Tdi Amf 332086999565
  143. Desk Mini Electrical Pull Pop Up Power Outlet 312402625373
  144. UK Women Holiday Boho Mini Dress Ladies Summer 582435821287
  145. Mono Jack Adapter 35 mm 1 8 Inch 123085316875
  146. My Little Pony W4 17 Blind Bag 132763655560
  147. 00 Gauge Bridge Tunnel and accessories 163435311723
  148. VW GOLF Mk4 PASSAT Mk5 FRONT RIGHT DRIVER 171395732742
  149. Fit For SUZUKI Hayabusa GSX1300R Fairing Fairings Set 132896922911
  150. Tanix TX3 Max Amlogic Android 71 Quad Core 123245894727
  151. 2x Tempered Glass Screen Protector For Apple iPhone 253797314114
  152. 2000 Today New Year Abc Vhs 323618001425
  153. The Warriors Way Blu ray DVD New FREE 132283610636
  154. STEEL CARABINER Small Snap Spring Clip Hook KARABINER 563648471294
  155. Click Define INGOT Flat Plate Stainless Steel Switches 532223687899
  156. The Price of Love by Anne Baker Paperback 132896502110
  157. Classic VW Volkswagen Camper Van Shaped Save the 282253571494
  158. Go Go Golf Sony PlayStation 2 2002 Used 202477487795
  159. Zoeva Rose Gold brushes Vol 1 make up 233050298733
  160. 28 EGR valve Blanking Plate Gasket for Citroen 171283607907
  161. Vintage Levis Denim Jacket Size L 283309025324
  162. Royal Albert Hamlyn Tea Cup Saucer and side 401647160977
  163. Rotiform Winter Alloy Wheels Snow Tyres 19 392191498410
  164. 35mm Male Plug to Dual 2RCA Jack Cable 143004492089
  165. Alan The Christmas Donkey The little donkey who 253991597127
  166. 2x Anti Roll Bar Bush Clamp Bracket Front Right Left for 311748545538
  167. Photo Studio Softbox Continuous Lighting Kit Adjustable 163311097835
  168. Filofax A5 Domino Patent Aubergine with Spots 173194840066
  169. 1867 Shield Nickel no Rays Free Shipping 273617214531
  170. Ninjago Lego Poster 260Gsm A5a4a3 Options 192462703419
  171. New Christmas Kitchen Tableware Holder Pocket Dinner Cutlery 323485599119
  172. Van Gogh Drawings Wheat Field with Sheaves 190969953941
  173. 2x 635mm 1 4 Male to 35 mm Female 372375025900
  174. 208 piece jigsaw puzzle Howls Moving Castle Art Crystal 312249764245
  175. John ThompsonS Modern Course First Grade Book 283308330726
  176. vintage royal stuart spencer stevenson harlequin trio yellow 183566760009
  177. Mens Outdoor Quilted Long Bubble Jacket Parka Padded 502423117716
  178. AUDI RS7 A8 A6 A7 S6 4X 21 INCH ROTOR S 183573223904
  179. Antique Silver Ball Hallmarked Dress Show Stick cane 36 192125358508
  180. Beads Vintage Round Faceted Acrylic Chalkwhite Pack 60 232866212580
  181. Strong Non Slip Rubber Floor Mats For SAAB 183525304119
  182. Purple Camo Ribbon Awareness Lapel Pin Pancreatic Domestic 312384762478
  183. MOTION PRO 1996 Kawasaki ZX750 Ninja ZX 7RR CLUTCH 142469639401
  184. 1827 Mansucript letter justice inventory document signed 132892677772
  185. For KTM EXC 500 ie Sixdays 2015 Prox 302059830679
  186. 2PCS 35W D2S Car HID XENON Pair Headlight 584159337633
  187. Good1405090766 The Princess and the WizardJulia DonaldsonPaperback 143068574472
  188. Fashion Women MultiLayer Long Pearl Necklace Pendant Sweater 441134020771
  189. 100 Egyptian Cotton towels Luxury Super Soft 283203710070
  190. Drop the Dead Donkey Series 4 DVD 2006 291654867534
  191. Universal 1 Litre Polished Aluminium Alloy Water Tank 162651762265
  192. GB 1981 Charles and Diana Wedding Stamp Set 264089492953
  193. Deep Frying Thermometer 150Mm Stainless Steel Probe With 122820629670
  194. Frankie Laine Greatest Hits 40 Original Recordings 351703268447
  195. Sterling Silver Cross Earrings Stud Earrings in Gift 552800332231
  196. RDX LED 73mm Clear Rear Light Kit 2 391652089891
  197. Vintage Wooden Jewellery Musical Box 253988261950
  198. 4400mAh Laptop Battery for Lenovo Thinkpad X230I X230 183545071624
  199. Action Comics 320 Fn 60 Dc Brian Bolland 141796850994
  200. Tuff Jug Quick Fill Fuel Cap Kawasaki Black 142959817672
  201. Incomplete Nokia 1208 Unlocked Grey Mobile phone Handset 283291140225
  202. Waterproof Car Pet Dog Front Seat Cover Blanket 254033097975
  203. Left side Wing door mirror glass for Kia 372197423583
  204. CLASSICS ILLUSTRATED 46 Kidnapped by Robert Louis Stevenson 382651309340
  205. SKODA SUPERB 3T Fuel Filter 14 18 20 332449992782
  206. Miniature Rail Guide Slide Linear Sliding Block 461906239457
  207. For Samsung Note 9 S9 S8 Luxury Slim 661114730266
  208. Toilet Roll Paper Holder in Chrome Square 143054917125
  209. Kids Baby Boys Girls Batman Tracksuit Outfits Set 541979633034
  210. Volkswagen Polo 14 80P 2007MY S 283282441070
  211. Shelby Cobra 427 AC Tee American muscle big 163114234069
  212. New Pierre Henry 6 Drawer A4 Filing Cabinet 202538536860
  213. Range Rover L322 New Genuine Centre Bonnet Control 264001300678
  214. 614 030 0045 MEYLE Engine mount fit OPEL 391396289224
  215. Display Box Car Figures Model Acrylic Mini Transparent 153317449365
  216. One Pair Aero Crash Protectors Honda CBF 125 183358640135
  217. The Who TOMMY Live At The 132896425001
  218. Rockola Cd Jukebox 6000X Main Power Rivet Connector 162607421867
  219. Bachmann Oo Gauge 38 286 Set Of 3 Presflo 192754856666
  220. The Post Blu Ray 123537787605
  221. Lacoste Unisex Goa Pink and White Strap Watch 223225170348
  222. Old Antique Print View Mausoleum Burns Dumfries Scotland 352540867605
  223. Mens I WASNT LISTENING T Shirt Top Funny 423650838320
  224. 8pcs Wood Plug Cutter Cutting Tool Drill Tapered 123316751242
  225. Battery for Toshiba Satellite L750D 194 L750D 199 L750D 19C Laptop 182935022062
  226. 0C42 Octa Core 10 4G 64G Android Sim Wifi 4G 64G 553080484352
  227. BCE CROC Standard Snooker Pool Cue Case %E2%80%93 303000566973
  228. DB9 DIY 9 pin Serial D Sub Connector Male 532283870303
  229. 101 Inch Tablet PC Android 70 Quad core Google 690953125537
  230. Japanparts Rear Shock Absorber Single Unit MM HY065 192683147155
  231. For Hyundai Tucson 2015 Chrome Wing Mirror Trim 401339668208
  232. Baby Formula Milk Powder Dispenser 4 Layers Infant 661095519869
  233. 2 Girls Hair Bows Bobbles kids Baby Ribbon 263686073055
  234. Ladies 60s 70s Retro Hippie Go Go Girl 271450337417
  235. Hyundai I30 2012 17 Offside Drivers Front Wing With 192740843190
  236. Waterworld Letterboxed edition Laserdisc laser disc 273623574538
  237. More Mile Mens Womens Ladies London Ankle Running 422883428844
  238. Newly A4 Light UP Letter Box Cinematic LED 651274549062
  239. 112 Scale 12 Loose Coke Bottles In A 262939951496
  240. VW Caravelle 25 TDi Bus Syncro 101 Drivetec 401520602416
  241. Blue Point 6pc Roll Pin Punch Set Incl 173665261883
  242. NEW One Week DVD 221802388207
  243. 11oz Ceramic Coffee Tea Mug Glass Cup Id 532299423530
  244. Kids Boys Girls Sports Jogging Joggers Cuff Fleece 690727641242
  245. LED Light Up Selfie Case Cover Ring Hold 641018421238
  246. Incredibles 2 DVD 2018 DISNEY PIXAR NEW 143059208303
  247. keepers Gloves Finger Save Football Goalie Flat Cut 561265530495
  248. Hubsan X4 H107D FPV RC Quadcopter Spare Parts 273156953722
  249. Brand New Bronze Colour Albert Pocket Watch 153179679071
  250. Austerlitz Penguin Essentials by Sebald W G Book 392148341326
  251. Levis 511 Slim Straight Leg Jeans Denim Grade 461226471822
  252. Cream jug milk jug vintage cut glass from 202535728614
  253. 20 LED Wine Beer Bottle Cork Fairy Lights Gold 601901385795
  254. EX650 A6FA7FA8F Ninja 650R USA 06 08 2008 High 141448938314
  255. Love Live Sunshine Collectors Edition Blu Ray NEW 352374680231
  256. Ladies Celeb Ribbed Polo Roll Neck Long 560524622411
  257. We Found a Hat by Jon Klassen Paperback 382472188316
  258. Tiger Kids Fancy Dress Safari Jungle Zoo Animal 552296677819
  259. SmallHD FOCUS BlackMagic Pocket Camera Bundle 223222953590
  260. Large Vintage Silver EPNS Tablespoon Serving Spoon 273623693814
  261. Last Tango In Halifax Series Two 192746734529
  262. Battlestar Galactica Premiere Edition P3 Binder Promo Card 391245812054
  263. Catalytic Converter RENAULT CLIO Mk3 16i 16v K4M800 172995477372
  264. Suzuki NOS SEAL SET PISTON 59100 41810 GSX1300R HAYABUSA 382690192940
  265. Jacques Vert Purple Wool Cashmere Coat with Buttons 222850025398
  266. Official Queens Of The Stone Age Cover Spray 121733984043
  267. VW Passat 3C2 19 TDI Genuine Febi Transmission 292829147447
  268. 1x Denso Radiator DRM12002 DRM12002 322961129271
  269. Enterprise Process Management Systems Engineering Process Centric Enterprise Sy 382652129406
  270. Mercedes CLK 320 CDI Cabriolet Diesel Performance Tuning 221546380000
  271. 128Gb M2 Ssd Solid State Drive For Msi 202397751923
  272. DOMED CABOCHON CLEAR GLASS OVAL ROUND SQUARE 620132911778
  273. Wooden Train My first train Wooden 283305249648
  274. 30 50 100PCS Magic Sponge Eraser Cleaning Melamine Multi functional Foam 362069638610
  275. Ribbed Ceramic Door Handle Reclaimed Salvage Victorian 254023731758
  276. 3XJewelry Mens Bracelet Genuine Leather Stainless Steel Bracelet 183384092620
  277. White Chapter Ring Clock Face Or Dial 152Mm 191075917726
  278. Mr Fothergills Veg David Domoney Tomato 332441341490
  279. Right Side Covex Wing Mirror For Suzuki Grand 122579928591
  280. Land Rover Range Rover 13 On Heavy Duty Green 362105045027
  281. MERCEDES E200 S210 20 Turbo Hose 97 to 332599265877
  282. OFFICIAL SECRET LIFE OF PETS DVD O RING SLIP 173557107867
  283. New Gildan Plain Sweatshirt Cotton Heavy Blend Crew 570998244628
  284. The Beatles Monthly Book No 3 October 1963 382669240719
  285. LUXURY SANTA NAPKINS Father Christmas Design Xmas Party 172391283517
  286. New Suzuki DR 250 RX Dakar Euro 99 113275834507
  287. 2 Vintage hatpins matched pair Victorian Edwardian hat 372385930946
  288. Ultimate Christmas Puzzle Book by Puzzler over 150 202468991061
  289. 10 20 50pcs N52 Super Strong Disc Neodymium Magnets Rare Earth 332782207711
  290. Edg 99 New Mens Straight Leg Farmers Work Mechanics 562308089451
  291. London Paralympic Games 2012 LOGO MIRROR No290 Pin 163443958076
  292. Luxury Ultra Slim Shockproof Case Cover for Apple 541468146453
  293. Shimano MTB Disc Brake Pads B01S Resin BR M525 113238180925
  294. Uncut Magazine Presents The Beatles A Life 253527814465
  295. Horror Movie Poster Collection 3 Wall ArtLaminatedA4Buy 2 Get 173681394174
  296. FRANCE 98 PANINI World Cup Panini 1998 183148358061
  297. Audi A5 2018 Diesel 30 TDI 286 Quattro 323511491268
  298. Pet Cat Kitten Interactive Crazy Ball Disk Amusement 453136059551
  299. Bayer Design Dolls Pram City Neo Pushchair Pink 173669351238
  300. BCE Unisex 6ft Pool Table 94 352317350604
  301. Flyer Poster or Banner DESIGN from %C2%A312 690717140470
  302. Autumnal Oliver Knussen 2012 CD NEUF 262192637300
  303. Falcon Eyes RX 18T 62W 792pcs LED Video Light 263899788867
  304. Kids Tassel Soft Sole Leather Shoes Infant Baby 563303286408
  305. Light Blue Red Frappuccino Frappucino Starbucks Card 302989645802
  306. RUSSIAN RELIGIOUS ORTHODOX ICON JESUS CHRIST PANTOCRATOR in 273574101990
  307. Renaultsport Renault Sport Window Sticker Decal Clio 172 400339309579
  308. ipega Newest Extendable gamepad Game Controller Portable Bluetooth 263857994228
  309. Digital Wall Stainless Steel Metal Thickness Gauge Tester 163150102250
  310. Ian Dury New Boots And Panties Lp With 362518434916
  311. Antique Victorian Scottish Sterling Silver Polished Agate 292885631830
  312. E KYLIN 12V24V Car Truck Backup Camera HD 323580514460
  313. Pink Floyd Piper At The Gates of Dawn 202541800072
  314. Airforce Sign Man Cave Garage Shed Vintage Gift 273561354881
  315. Alloy Wheels 18 Dare DR F5 Silver Polished Lip 382584760915
  316. Personalised Marble Floral Grey Monogram Name Gel Phone 492730307625
  317. H80 H91 Lacquer Nail Polish%E2%80%9C H%E2%80%9C 323581941793
  318. Wife Mum Boss T Shirt Unisex Womens Slogan 532444305866
  319. Natural 200 Ct Diamond Real Emerald Ring 14K 192758817652
  320. CCC British and Irish Lions 2017 Womens Matchday 362107012022
  321. Ben Sherman Black Oxford Shirt 2XL to 5XL 472253829852
  322. Herge The Adventures Of TinTin The Blue 352288033171
  323. Incredible Hulk Returns The Trial of the Incredible Hulk 162204973247
  324. IRIN 4 4 1 8 Folk guitar string A108 chord 6PCS 232797430052
  325. Gates Drive Belt Fan Rib Belt Alternator for KIA 371734429637
  326. 3x NGK ENGINE SPARK PLUG SET PLUGS 4120 153049320851
  327. Transporter 3 DVD 2009 163447568034
  328. HEKO wind deflectors front set 2 piece LAND 173075202062
  329. Vinyl Record LP Album KENNY ROGERS THE 173702128169
  330. The Fry Chronicles an autobiography HB DJ 2010 113476084676
  331. Spot it Flash Pair kids game for 563589291053
  332. Studio Photography Softbox Lighting Kit Background Stand Free 252573577647
  333. Waterproof 12V Car Cigarette Lighter Socket USB Charger 123375394933
  334. Angelina Ballerina All Dancers On Deck Dvd 392199195529
  335. VW Golf MkIII 19 TD Estate 74 Front 282925420701
  336. NEW The Rolling Stones From The Vault No 143055346538
  337. 1914 3rd C L Y Sharpshooters 392200259278
  338. MAXSTRENGTH Boxing Focus Pads Hook and Jab Pro 630275135601
  339. Home Office Chair PU Leather Adjustable Swivel Executive 223184813626
  340. THE CLASS OF 92 2013 DVD New 264054789959
  341. Nuvo Lighting 62 977 1 Light 14W Integrated LED Flush 401665122754
  342. LAS VEGAS US MADE Embossed Sign 332371751068
  343. Fiat 500 14 07 103KW 140 HP Racechip 162911410430
  344. Bill Oddies How to Watch Wildlife Bill Oddie 312258320897
  345. HAYLEY ATWELL Signed 16x12 Photo THE SWEENEY 173695288758
  346. T Shirt Bradford City AFC FC Football Casuals 253945039414
  347. Accessory Kitbrake shoes for FIAT MAREA185182 A2000MAREA Weekend185 113375254304
  348. 4 5 Manchester United adults S 7 Ronaldo 2003 183341043973
  349. DMC Dance Mixes Issue 178 Chart Music DJ 311802454064
  350. Ldv Convoy 2000 Deluxe Blue Racing Van Seat 362117582094
  351. FIAT 4pcs 68 65mm Wheel Centre Caps Rim Hub 263277545450
  352. Blue Stitch Fits Vauxhall Combo Corsa B C 231470456375
  353. Girls 30th Birthday Gift Girls 30th Birthday Silver 321400286553
  354. SPIDER MAN HOMECOMING Movie PHOTO Print POSTER Tom Holland 132572002422
  355. FIAT ULYSSE 95 03 Black Car Van Seat 142960732313
  356. Fuzzy Rabbit Fur Plush Soft Silicone Case Cover 263950565343
  357. YUNZHIQU Transparent 49 61 Key Electronic Keyboard 88 113033570862
  358. Barca 2007 2008 FC Barcelona HOME shirt jersey 282667345792
  359. Aluminum Tripod with 3 Way Head Bluetooth Remote 273592734015
  360. 2007 Land Rover Freelander 2 22 TD4 GS 123366714658
  361. Butlins Skegness The Monorail John Hinde Ltd 3Sk65 372533501884
  362. Rise Of The Guardians 400850379649
  363. Screwless Flat Plate Brushed Chrome Light Switches 540994930815
  364. New 3 x 4m 120g Waterproof Outdoor PE 584065881294
  365. Mens Jungle Trim T Shirt Military Hunting Army 511183789230
  366. SHOCK PROOF CASE COVER FOR APPLE iPhone 4 590914302777
  367. 40PC Toddler Kids Plastic Kitchen Cooking Toys Utensils 401655747160
  368. Triumph 900 America LT 2017 MBTX12UHD MotoBatt 142952717460
  369. Rockoff Trade Mens Flightcase T shirt Black Small 401528373704
  370. cancer picked the wrong princess charity race for 413421523519
  371. Babyliss For Men 7498CU Powerlight Pro 15 Piece 163297254498
  372. Oz The Complete Fifth Season DVD 2005 382501810440
  373. Fashion Women Men Geneva Nylon Canvas Band Military 292178891012
  374. The Norfolk Yeomanry Large Size Cap Badge George 272275461612
  375. Pokemon Gyarados Pikachu Magikarp Soft Plush Anime Stuffed 252975725081
  376. 192 Sqft Interlocking Eva Foam Mats Tiles Gym 502369982904
  377. Medal Ribbon for Sports Day Prize Giving Various 650812704492
  378. Qi Fast Charging Samsung Galaxy Wireless Car Charger 202061356377
  379. DOL LOL Surprise Doll Park house Game slide 563642438245
  380. 1pc 116mm Plastic Mill Hand Wheel with Revolving 233026863860
  381. Cute Cat Gel Pen Black Ink Pen School 183367202288
  382. Antique Vintage Solid Brass Door Handle unique design 142434622238
  383. National Geographic Microscope 300x 1200x with accessories 253678446685
  384. Offical 2018 England CRICKET Trading CARDS 1 100 532414623499
  385. Cumbria Cumberland Westmorland antique map by Aristide 123504032801
  386. Samsung Np 305V5A Laptop Windows 7 Amd A6 Webcam 292492943507
  387. Pink Floyd Dark Side Of The Moon Lp 283283788637
  388. Crankshaft Pulley for Citroen Peugeot Xsara 306 273459367177
  389. Live At Shea Stadium Clash Compact Disc 282971223369
  390. NEW SHFiguarts Kaizoku Sentai Gokaiger Gokai Yellow Action 122962171126
  391. Amy Winehouse Celebrity British Jazz Singer Cool 601812405247
  392. Merlin%E2%80%99s Premier League 2006 2007 400 to 499 Please 202270406982
  393. Clive Barkers Jericho Special Edition Steelbook Boxed 302999475843
  394. Violin Labelled Joannes Gagliano Nepos Januari Fecit Neapoli 323587346781
  395. Unstoppable Cards Limited Edition Autographed Card 651420828423
  396. Seat Alhambra 7V8 7V9 1996 2010 Amtex Rear Shock 381759448570
  397. Smart Window View Flip Smart Retro Leather Case 392178561339
  398. Kids Baby Girls Purses Princess Handbag Cute Pearl 601560968530
  399. Renault Modus Hatch Variant1 ACP Exact Specific Fit 232440200052
  400. 1996 IVECO DAILY 358 MWB motorhome 163349083715
  401. Perfect Love Gift For Girlfriend Ideal Present Mother 302567482430
  402. Fabric Cloth Foldable Storage Bin Bag Closet Toy 553138616840
  403. FOTGA DSLR Camera Cage Kit w 15mm Rod Rig 283299732993
  404. 60x Individual Flare Cluster Eyelashes Knotted Lash Extensions 332921595450
  405. UK 5x7FT STUDIO PHOTO PHOTOGRAPHY BACKDROP WOOD WALL 563523169970
  406. MASTERPIECE THEATRE ROOM WITH A VIEW Region 1 163358910603
  407. GERMAN ARMY IN NORMANDY 12th HITLERJUGEND PANZER DIVISION 392190748605
  408. Splendid Taiwan Interpur Boxed Battery Toy big Machine 392197665023
  409. DISCS ONLY 24 Series 1 Complete DVD UK 183592919306
  410. Fit with ISUZU RODEO Glow Plug ADZ91819 25 392093684542
  411. Diesel Oil Filter 48140118 For Bmw X5 Xdrive 121600345921
  412. Polistil Serie S 02300 ferrari Mondial Racing Car 362498365038
  413. First Line Water Pump Gasket FWP2375 163311294292
  414. Dolls House Miniatures 112th Scale Photo Frames 2 181814863184
  415. Bmw F650Gs F650 Gs Oem Riders Front Left Footrest 401434771260
  416. Citroen Synergie MPV Bosch Superplus Passenger Window Windscreen 291681808306
  417. Mens Branded Slazenger Long Sleeves Fleece Hoody Size 281843418765
  418. AG13 LR44 G13 Alkaline batteries 357A 223214524516
  419. 988 HD 1080P Touch Screen 4G ADAS Android 152872122122
  420. Fixed Swan Neck Towbar For Ford Focus C Max 292157577905
  421. Genuine Oil Dipstick Fits AUDI VW 100 Avant 283249514953
  422. Wall Clock Vintage Shabby Chic Animals and flowers 263853167270
  423. Trend Fast Track Diamond Super Fine Finishing Stone 302218073986
  424. Ford Anglia 105E Estate 307E Van 332011368144
  425. Vintage Art Deco Lapis Blue Glass Graduated Bead 183566387371
  426. Playfair Rugby Football Annual Book 1956 1957 391643740551
  427. BATTERIE LITHIUM SHIDO Garantie 3An LTZ7S Honda CBF 121571371106
  428. VAUXHALL VIVARO SERVICE BOOK HANDBOOK WALLET PACK 151122557130
  429. SWAG Front Propshaft Joint Flexible Disc Fits VW 152629823144
  430. Ladies Mens Wash Bag Travel Toilet Bag Hanging 302379264544
  431. MINTEX FRONT DISCS AND PADS 260mm FOR DACIA 121829322060
  432. Modern Geometric Design Area Rug Contemporary Soft Large 401408608569
  433. Used HF KP23 M01 Tested Mitsubishi Servo Motor 1Pc ui 132615397576
  434. Handmade Kids Decorative Cushion Made To Order Nursery 222855717346
  435. Luxury Aluminium Mirror Case i Phone Cover for 531405847186
  436. Ford Panther Black Touch Up Pen Bottle Brush 441436150278
  437. Antique Pine Solid Wood Photo Frames Wide Distressed 121081917994
  438. 1g 5kg 10kg Digital LCD Electronic Kitchen Household Weighing Food 553258608044
  439. Salt Of the Earth Unscented Spray Deodorant 200ml 441857071488
  440. HPI BAJA 5SC Steering Suspension Genuine HPi 461084427867
  441. Hex Wives 1 Mr 31 10 2018 263975802831
  442. RG RACING RHS ENGINE CASE SLIDER Triumph Speed 192626132759
  443. White Collar Season 4 DVD 392040263297
  444. Shutter Release Remote Control Infrared Canon EOS 600D 372155330639
  445. Speedy Victory 28mm Metal Curtain Pole Sets 552913668002
  446. Wheelys Jazzy Kids Girls Boys LED Light Heelys 183572667112
  447. EDWARDIAN 035ct RUBY 056ct OLD CUT DIAMOND 223167036027
  448. Panasonic Lumix G 20mm f 17 II ASPH Lens 153200739993
  449. Dental Wrench Ratchet 40mm Square 4 Hex 202293260010
  450. CITROEN C2 Hatchback 03 FE37172 323600106397
  451. The Calculus Affair The Adventures of Tintin Hardcover 352311916621
  452. A Shot at Love Sweet Dreams by Jarnow 302846327066
  453. HP Laserjet Pro M227sdn A4 Mono Multifunction Laser 143031274658
  454. POLLY POCKET Vintage Bluebird 1995 Dress Shop NEW 254037159798
  455. 12291 Mike Tyson Boxing Boxer Vintage Art Poster 581698540809
  456. MICROSOFT SURFACE BOOK 135 i5 6300U 128GB SSD GPU 202538651784
  457. Scarpa uomo GF GIANFRANCO FERRE camoscio 44 shoes 143036638755
  458. 3x 9mm Bluetooth Ear Hook 252993475683
  459. Football Pump soccer rugby bike bicycle foot ball 540724749098
  460. Reusable Soft Face Paint Stencil Body Template DIY 562539754270
  461. SAMBA 6 x 4ft Football Goals Locking 263508676547
  462. VW Passat 3B2 23 VR5 Genuine Febi Engine 291809488155
  463. No 39 Ford Escort Mk1 RS 1600 c1970 264030553812
  464. Kids Girls Baby Toddler Minnie Mouse Costume Birthday 591438948085
  465. GENUINE VW PASSAT B8 Estate 2015 2017 233018567496
  466. Max 50KG 8 Metre Good Dog Lead Leash 553050010842
  467. Berties Bows High Quality Vintage Style Floral Grosgrain 322189989684
  468. COLLECTORS EDITION of Just Cause 3 for XBOX 132890270943
  469. Spelling for Literacy for Ages 7 8 Paperback Brodie 352458178390
  470. Black Real Leather Manual Gear Handbrake Gaiter 232306875399
  471. Screwless Flat Plate Brushed Chrome Light Switches 540914496150
  472. US SELLERartificial Kung Fu Panda 825x575 large body 264044439576
  473. B Ware Einstiegsblech Schweller Links F%C3%BCr 6926919 6520001 302412521769
  474. Vintage Herbert Terry Anglepoise Stepped Base Table 253988626222
  475. Clarks BNIB Originals Mens Chukka Boots BECKERY HILL 362505138899
  476. Magic DVD NEW SEALED MVDVD TH733 361831959591
  477. New Genuine HELLA Fuel Tank Closure 8XY 004 192391291477
  478. Aluminum Radiator for Honda CRF450R CRF450 CRF 450 222646628643
  479. Boxed Wwe Finn Balor Demon Elite Collection Series 273585431927
  480. FM Screen Photo Studio 3D Pattern Photography Photo 591446425407
  481. 1 5PCS Office Home Drink Cup Holder Clip Desk 273189978982
  482. YAMAHA TX650XS1XS2XS650 ENGINE GEARSHIFT FORK 4th GEAR WHEEL 192576796324
  483. 3 x A4 Sheets Glitter Card Varous Colours 400297300544
  484. 2x 91 90315 210 RTS FRONT TRACK ROD END RACK 263706801502
  485. Ambiance FLEUR RUSTIQUE Set of 4 Dinner Plates 132296726888
  486. 50g 50 60MM Natural Colorful Fluorite Quartz Crystal Wand 222658149563
  487. Orig VW Passat 3c 3AA B6 B7 Headrest 113404516799
  488. UK Braided Micro USB Fast Charger Data Cable 492885717206
  489. Vintage Japanese Egg Shell Porcelain Set of Three 163422942030
  490. M4 Cap Head Socket Screw Allen Bolt Steel 600048772106
  491. Everbuild Kos Fire Cement Black 362216098961
  492. EPS %C3%96ldruckschalter 1800166 f%C3%BCr OPEL MOVANO Kipper H9 382662993786
  493. FORD Focus Mk 1 Transit Connect Tie Rack 141929755855
  494. GB MNH 1979 Dogs traffic 302998386776
  495. 1873 Beers Map New York State Vintage Framed 282482531455
  496. Charlie Bears STRAWBERRY CHEESECAKE 2011 Non UK Isabelle 233049477236
  497. Left Side Engine Stator Cover Motorcycle For Suzuki 232806924302
  498. New Kitchen Strong Adhesive Wire Storage Plug Holder 461676542679
  499. The Great Game On Secret Service in High 192711936377
  500. Acqua di Parma Colonia Intensa Eau de Cologne 273615408921
  501. Salo or The 120 Days of Sodom 1975 283292013006
  502. Breathable Mesh Pet Dog Cat Harness Step in Puppy 661089890684
  503. Rhodesian Ridgeback Love You Dad Photo Snow Globe 362170514741
  504. First Line Front Stabiliser Rod Strut Link 173585377332
  505. Mens Funny Novelty Slogan Joke Rude Gifts Birthday 601812776632
  506. Ink Junkie T Shirt Tee TShirt Funny Rude Offensive 562467539186
  507. DVD La Vie En Rose DVD 2007 2 Disc 323246520835
  508. Baby Musical Swinging Viberation Bouncer Chair Toddler Comfortable 222215183655
  509. Pair vintage wooden heigh chairs 153318893686
  510. Jaguar Xf 3 Litre Automatic 223282757211
  511. CND Shellac Gel Polish Nude The Collection 132497287899
  512. NEW Ladies Classic TITANIUM Magnetic Bracelet Magnet Therapy 291938905513
  513. Diamond Rio Keys Lost keys Replaced Extra keys Locksmith USA keys by code number 390754385545
  514. Malaguti R 125 Madison 2004 Sintered Motorcycle Front 300679969743
  515. Get it Summerhits Die besten Songs 292862475557
  516. Pair of Princess Diana Commemorative Framed Memorabilia Pictures 273615503338
  517. Roe Deer Antlers on skull Taxidermy Home 153230088213
  518. Bill Clinton James Patterson Signed Book The President 233040947400
  519. Womens Ladies Chunky Knitted Knot Twist Front Wrap 601797571909
  520. Macy Gray The Id 173612033682
  521. adidas Terrex Agravic GTX Hi Res Red Core Black 392117578813
  522. Clan of the Cave Bear Earths Children 1 332738465536
  523. Panel Mount SPST 1NO Momentary High Flat Head 382420394363
  524. Rear Continental Wheel Bearing Kit For Fiat Ducato 111453237799
  525. 2201 5 Lever Mortice Sashlock 621524392059
  526. Blue Lilo Stitch Disney Official Lying Soft Stuffed 401650559335
  527. PE Foam 3D Brick Wall Sticker DIY Wallpaper 453069193779
  528. 12Pcs ZOEVA MAKEUP BRUSH SET BRUSHES BLACK 153272229188
  529. 3D Animals Silicone Mould Chocolate Fondant Sugarcraft Cake 690730509172
  530. Various Artists RB Collection Parental Advisory Album 2 CDs 331677143223
  531. 1 Pairs Propellers Main Blades Rotors Prop Part 202221105105
  532. For Samsung J4 J6 J7 Pro A6 Plus 223073326535
  533. Comptons Most Wanted CMV Straight Checkn Em12 OOP 351943184624
  534. Wales Map Educational Poster Wall Chart Cymru 453167867739
  535. Moisturizer for Dry Skin 17 fl oz 263422702645
  536. Match Attax 17 18 AFC Bournemouth Arsenal Brighton 660873664955
  537. Bare Bones Temperance Brennan 6 Reichs Kathy Very 263134432820
  538. 3 Hook Ceiling Rose Plate Light Fitting Glass 440265905414
  539. Ride Along Region 2 DVD sealed 163303181433
  540. Wireless optical mouse and mouse for PC laptop 123505117992
  541. FORD FIESTA 02 08 Black Red Racing Front Pair 142962448677
  542. 50 100 x Clear Self Adhesive Peel Seal 511277770274
  543. Limited Offer BVLGARI MAN Wood Essence Eau De 183455822993
  544. Slade Promo Cd Includes Merry Xmas EverybodyFree 111737218264
  545. New Orleans Gumbo The Absolutely Essential Collection 391578603941
  546. KN Oil filter For Kawasaki 2012 Z1000SX KN 303C 360583834966
  547. Superman 183 80 Page Giant 30 G VG 292877451049
  548. 24 48V Brushless Motor Controller with LCD Panel fr 113425389272
  549. Star Wars A New Hope Episode IV Marvel 132075399146
  550. Air Filter to fit HONDA CBR 301725272706
  551. RARE DY 28 Triumph Motorshow 1992 creme Dinky 332856475863
  552. Embroidery and Animals by Messent Jan Hardback Book 142252680796
  553. Folio Society Complete Bronte Novels Jane Eyre Wuthering 233033254944
  554. steel wheels MERCEDES BENZ C Klasse Coupe 203CL 205 55 R16 273606536142
  555. Audi A4 Saloon Avant range brochure pack 332930821700
  556. Finger Hand Spinner Fidget Tri Spinner Autism ADHD Stress 262974831287
  557. Filippo Inzaghi Signed AC Milan Branded UEFA Champions 362418570317
  558. Gino Cerruti Black Sateen Ball Gown Two Piece 123545518088
  559. 1897 O Morgan Silver Dollar Key Date VG Very 301310128954
  560. House Closet Door Adjustable Screw Spring Roller Copper 283029284289
  561. Hanimex 28mm f28 Prime Lens For Pentax PK 202521816082
  562. Pairs 3D Natural Make Up Soft Handmade Thick 462769434686
  563. QA LC Womens Pet Cat Dog Paw Pendant 132721818362
  564. Fits Hyundai ix35 20 CRDi 4WD Variant1 Genuine 362114136513
  565. Supergirl Vol 4 26 Near Mint 283303847767
  566. 491540 Coin Aemilius Denarius 114 113 BC Rome EF40 45 202204207240
  567. 6W 50W GU10 LED Spotlight Light Globe Bulb SMD 183594165402
  568. 10 50pcs 12mm 26 Patterns Round Glass Cabochon DIY 584145076109
  569. Star Personalised Baby Dribble Bib Bandana Any Name 562513947467
  570. Niccolo Rising The House of Niccolo Dorothy Dunnett 312354095218
  571. Lane Widening Eibach Pro Spacer OPEL ASTRA J 132454588784
  572. 10pcs Soldering Iron Solder Tip Welding Cleaning Sponge 192566206788
  573. 2 pieces Viking 4GB Kits DDR2 800MHz PC2 6400S 223238142452
  574. 1 2 3 4 5 6 Pin Way Seal 153291048417
  575. 2 4 8x H7 XENON COOL WHITE 100W BULBS DIPPED 620510759495
  576. Baby Boy Girl Romper Babygrow Jumpsuit Bodysuit Playsuit 581784310670
  577. Darth Vader T Shirt Funny Darth Evolution 142851905371
  578. Kids New Thomas Friend Style Train Motorbike Ride 571907880820
  579. Funny Silly Rude Alternative Anniversary Card For Her 163134861698
  580. Eminem Wembley London 2014 Autographed Signed Music Photo 202317461398
  581. Custom made Skiing I Dont Always Go oh 263560659203
  582. Home For Christmas New Dvd Mickey Rooney Magical 222922194423
  583. Pair Bergeon screwdriver blades QUALITY 05mm 2mm 321299768448
  584. RKH71 SALE Hearts Roses Rockabilly 50s Tartan 390978434717
  585. New Evergreen Garden Flag Double Sided Emboidered Appliqu%C3%A9 282400791829
  586. Christmas Scarf Xmas Father Santa Claus Secret Ladies 122751516566
  587. Dell PERC H310 PCI e SAS Controller 0HV52W 253587799070
  588. Rare vintage Irish signedTyrone candle sticks holders 132867749978
  589. 3845CM Car Cleaning Towel Wiping Cloth Car Care 273327395814
  590. Girls Boys Lycra Sports Cycling Shorts School Gym 163093858175
  591. DVD FILM STALINGRADONew and sealed 283311396519
  592. Snow Scene Old Oil Painting Cornish Landscape Signed 302977074434
  593. Robert E Lee Civil War 11 x 14 132772653548
  594. Vintage Lufkin 863L Boxwood Brass Combination Rule 263711033321
  595. Beds Bedfordshire LUTON Town Hall George St 1906 151553686298
  596. Elvis Presley As Recorded At Madison Square 254046218941
  597. My First Words Interactive Learning Board Book With 223235138348
  598. Italien Italie Italy Italia 1980 82 Castelli serie completa 292678546583
  599. Baby Toddler Infant Boy Girl Unisex Leggings Trousers 450145654285
  600. 2 X Knee Sleeve Compression Brace Support For 562581188687
  601. 3x pairs 3 4 Length Orthotic insoles great arch 562348671544
  602. JVC HAEC10B Sports Sweat Proof Ear Clip Earbuds 263862882421
  603. Bloggers ZARA ethnic hippy boho folk button front 173699354810
  604. Well Inside Remote Interior Led Glow Full Foot 424084119100
  605. Domino A360 Off Road Comfort Grips Black 223056312026
  606. New Grade 9 1 GCSE Combined Science AQA Practice 362177375941
  607. 2015 Topps Platinum Gold Matt Forte Chicago Bears 273622685717
  608. Exhaust Gasket for Jinlun JL125T 13 Scooter 311982245703
  609. Personalised Lambretta GP200 Key Ring or Dog Tag 600184489210
  610. 1 2Set 2018 2019 Calendar Sticker Paper Diary DIY Decal 462475420399
  611. manchester midland hotel winter garden picture postcard unposted 264077747845
  612. Heavy Duty Non Slip Dirt Ribbed Barrier Large Small 492134267869
  613. Memory Ram 4 Desktop PC DDR2 PC2 4200 511907177057
  614. Everbuild Industrial Grade Superglue GP All Purpose Adhesive 253702329048
  615. Fits Honda CB 750 K SOHC USA 1969 1978 112280000854
  616. Small Pet Warm Plush Cloth House Chinchilla Hammock 153134286759
  617. Citroen C4 Picasso 2007 2013 New Choice Of Black 453023497313
  618. TOPRAN 101 457 Coolant Flange 113451031966
  619. Kung Fu Panda DVD 2008 323605442256
  620. BLOC PARTY Silent Album INDIE 123528299179
  621. Wooden Shape Sorting Clock Educational Toy for Kids 302973520551
  622. Mini Moto Green Easy Start Pullstart 49cc Pull 173136774539
  623. Center Stand ConStands Power GR Yamaha MT 09 13 19 401444573626
  624. Apple Watch Series 4 Case iwatch TPU Screen 553328158220
  625. Digitizer Display White For iPhone SE 5S LCD 283134325498
  626. 2018 VW AMAROK AVENTURA BREAKING SPARES COMPLETE FRONTEND 113298073972
  627. 2Pcs 24SMD LED License Number Plate Light Lamp 232999094027
  628. UK Women Long Sleeve Ribbed Bodycon Off One 502491397440
  629. 07Bb02Sd Rear Brake Pads Brembo Indian Scout Sixty 272830748740
  630. Tito Gobbi 100th Anniversary Edition 2013 DVD NIEUW 121996560267
  631. 2X White Car Interior Dome C5W 16LEDS 4014 273393856154
  632. Unisex Fake Magnet Rhinestone Ear Lip Ring Stud 472218768799
  633. Mercedes Sprinter 13 on GREY MotorRacing VAN Seat 132196473837
  634. Comic Relief Does Little Britain Live DVD 2007 202094965290
  635. 10x Yamaha FZ6 FAZER 2004 2009Titanium Front Disc Rotor 112790941284
  636. Secret Garden Black Beauty Dvd 162224506770
  637. Madden NFL 17 PS4 VideoGames 223306808674
  638. New White Patent Evening Clutch Bag Prom Wedding 550358856642
  639. Antique1 4smallSize Violin 253928346039
  640. Goldfren S33 Rear Brake Pads Garelli XO 125i 142889367379
  641. Garden Pot Holder Modern Plant Hanger Flower Legs 202524569181
  642. Honda CB72 CB77 Kickstarter Gear NOS 28211 268 010 132875954199
  643. Yamaha MT 09 FZ9 2017 2018 323272420005
  644. Exhaust system black for Harley Davidson Iron 264099069558
  645. S8 MAX Smart TV Box Android 81 RK3328 372524863023
  646. HiFlo HF143 Yamaha SR 125 1980 2002 171560967615
  647. Fashion Dance Shoes Professional Dancewear Ballroom Women Ballet 671395011286
  648. Luxury Black Leather Automatic Mens Casual Waistband Waist 283027483979
  649. Crazy Toys Marvel Comics The Punisher 1 6Th Scale 283028096902
  650. High Quality Rapyal Fabric Charcoal Divan Bed Base 201094088306
  651. Letts Make It Easy English Age 4 5 132854649654
  652. USB 30 Dual Band WiFi Adapter 80211AC 1200M 183583215225
  653. Denby Greenwheat Tea Pot 15 Pints 323609561622
  654. 107 920 Topran Coolant Flange Pipe P 263950086436
  655. Rookie Blue Season 1 DVD Region 263069202798
  656. MILD STEEL SQUARE BAR SOLID METAL ROD 10 12 16 20mm 571777247131
  657. Honda XR80R 1985 2003 Showe Rear Wheel 152603577613
  658. For Peugeot 207 Real Black Leather Steering Wheel 281231218447
  659. Elegant Designer Womens Long Nightie Ladies Full Sleeve 560782470853
  660. PACK OF 10 BLACK STUDIO RACK MOUNT M6 222469961335
  661. Childs Pirate Captain Fancy Dress Hat EVA 132865551683
  662. Sugarflair Powder Puff Glitter Dust Regal Gold 10g 254008632367
  663. Magic Mirror Photo Booth HIRE ONLY 2 hours 223054673875
  664. Antonin Dvor%C3%A1k Dvorak Symphonic Works CD 2012 381285491573
  665. 2 x KONTROL Moisture Damp Traps Dehumidifier 401255770167
  666. PACK OF 12 Play Doh Single Tubs 130g 222635624694
  667. Fashion Charm Women Metal Pendant Choker Chunky Statement 572817230656
  668. 2pcs Turn Light New Silver 12V Car Signal 223214129146
  669. 10x christmas 3D nail art decoration glitter rhinestones 113392064796
  670. Snoopy Come Home The Movie DVD 5030697031730 362471286202
  671. Genuine HP 951XL Yellow Ink Cartridge for OfficeJet 323576162105
  672. Royal Navy Petty Officer Lapel Pin Badge 251684338457
  673. Apc smart ups 1500 2200 1000 Battery UB1280 12V 361191432889
  674. World War II Minifigure Infantry American Army Engineer 572959602671
  675. 2013 BMW 5 SERIES 20 Diesel Saloon NS 401348634333
  676. Memorial Spike Flower Vase Photo Plaque 253927409471
  677. 45PP3 1 Rail Fuel Pressure Regulator Sensor For 192474478189
  678. 1 or 3 Pairs Flat Top Aviator Sunglasses 492836866386
  679. Modern Horizontal Oval Panel Radiators Colour Size 610250086182
  680. New Hanging Hay Grass Manger Rack Feeder Rabbit 223274251893
  681. Ayakashi Samurai Horror Tales Vol 1 Goddess 252561733583
  682. Cross My Heart HerreraHook Audio CD 143050262669
  683. 2x12mm 2x20mm Silver Wheel Spacers Black Bolts Locks Seat 263743203265
  684. Corner Removable Side Table Computer PC Desk Office 173503102420
  685. Lilo Stitch Hard Case Cover For Htc Huawei 660526315961
  686. Mr Robot End Of The World Party 322677301490
  687. Comline Front Right Track Tie Rod End CTR2023 163030769407
  688. Bnwt Youth Goalie Gloves Nike Junior Match 202514761780
  689. 979C Charm Eye Liner Pencil Eyeliner Liquid Pen 312389667302
  690. AQA GCSE Physics Student Book AQA GCSE Science 142042067971
  691. Bernhard Langer Signed Auto Augusta National Masters Scorecard 132659937453
  692. Hugh Jackman Actor Wolverine X Men Actor Poster A4 511402123931
  693. FlySight 7 inch Black Pearl Diversity FPV Monitor 192725429453
  694. Research on Teaching and Learning Mathematics at the 312375060758
  695. Belt Dayco RMS PIAGGIO 400 MP3 MIC 2008 2009 163750680 282716203898
  696. Masonic Regalia Craft Master masons MM Apron ImitationOfficer 511229062696
  697. Baby On Board Funny Car Sticker Hangover 173642983361
  698. New Hot Rods Yamaha YFM Raptor 350 04 13 143010778379
  699. Yemen Flag Shield Embroidered Patch Badge 380864907405
  700. Electronic Pocket Mini Digital Gold Jewellery Weighing Scales 282777866814
  701. For Suzuki%C2%A0Rm%C2%A0250%C2%A01987 87 Steel Rear Sprocket 41 Teeth 142035577898
  702. Waterproof Pet Dog Boot Mat Liner Protector LAND 123409072676
  703. Motorcycle Bike LED Amber Turn Signal Blinker Light 192731619345
  704. Ah Sprite Mkiii 58 63 Mg Midget Mki 61 63 252645797326
  705. BMW 3 Series 316 E30 Saloon MAR 1983 152768982946
  706. PU 150 Quick Release Plate 150mm for Benro Arca 283265359987
  707. IT DVD Digital Download Mint 233010929483
  708. Vision The Scarlet Witch 2 3 273608332719
  709. UTILA Swiss made Antique Pocket Watch 223025595018
  710. 2009 Ford Focus TDCI 18 Litre Diesel 5 361941110071
  711. Exquisite Gift Handmade Lifelike Reborn Doll 22 Realistic 183344500216
  712. FSS German DARK PLUM PURPLE Comfort Padded CURVE 590232366139
  713. Nike Mens Joggers Tracksuit 3D Logo Jogging Bottoms 113384047552
  714. 2X Tea Stainless Steel Drinking Yerba Mate Straw 532427210445
  715. New Heated Back Seat Remote Control Massage Chair 173458305053
  716. 12X Clear Lcd Front Screen Protector Cover Film 151851995526
  717. 350Mm Pull Out Wire Basket Kitchen Larder Storage 173581586306
  718. Hazard Light Switch for VW GOLF IV1J1AGRALHAKLAEHAPFAHFASVAGPAQMAHW 113319289615
  719. Replacement AC Power Adapter Laptop Charger for HP 182530218785
  720. Classic Mens Slim Skinny Woven Tie Knit Tie 282999987365
  721. Paracord 550 x 100 Foot CHOOSE FROM 300 253992733418
  722. FORZA Pro Football Goal Target Sheets Goal 302555986394
  723. FLOUREON 4CH 8CH 1080N AHD DVR 2 4X Outdoor 1500TVL 283015029537
  724. Tom And Jerry Jack To Mame No Ki Japan 323603001383
  725. Heavy Free Standing Boxing Punch Bag Stand Kick 123506714133
  726. Jade bonsai Perfect bonsai Portulacaria afra 233044099177
  727. Thank You For Being My Godparent Godmother Godfather personalised 690325730564
  728. Dental Floss Interdental Brush Teeth Stick Toothpick Flosser 352392873126
  729. 10x VW Volkswagen Interior Door Card and Trim 123367064732
  730. steel wheels VW Golf VII Variant AUV 205 55 273605750250
  731. Memory Foam Mattress Orthopaedic Reflex Sprung 3FT Single 591444769711
  732. BONNIE RAITT ORIGINAL ALBUM SERIES 5CDs NEW SEALED 272708320215
  733. Living Folklore An Introduction to the Study of 283308928296
  734. NAUTICA Mens Polo Shirt Large White Cotton 162959416831
  735. Hercules In New York Schwarzenegger DVD 132888780353
  736. 2 X Clear Green Silicone Thumb Stick 321974511995
  737. Wessex Tales by Thomas Hardy 264077626359
  738. MICHAEL KORS JET SET ITEM Black Saffiano 372546404066
  739. 26 Letters 10 Numbers Foam Floating Bathroom Early 254041281173
  740. 10 X Audi Door Panel Card Trim Clips 182455040183
  741. Velbon Df 40 Adjustable Tripod Stand For Camera 173662698372
  742. Servo Pump for Iveco Daily IV 4 V 302359715553
  743. 10 NON OEM Ink Cartridges For Canon MAXIFY 2500XL 351741001816
  744. AN8008 Multimeter True RMS Wave Output Digital Counts 651420340727
  745. Child Baby Corner Edge Furniture Protectors Soft Safety 431192370840
  746. 100 Recycled Two Ply Bath Tissue 336 Sheets 48 CT 163438243618
  747. 2019 Kawasaki Ninja 6500 Finance On This Bike 153249430158
  748. 2017 18 DUNFERMLINE ATHLETIC v BRECHIN CITY 123564834396
  749. 10X Magnifier Magnifying Glass Handheld Jewelry Loupe Reading 223182311173
  750. 2x H7 Xenon Bulbs 100w 12v White To 332822952870
  751. Pro Bolt Titanium Fairing Bolt Kit Purple FDU055TIP 332644838893
  752. Interior Woodstain Concentrated Solvent Free 484864246118
  753. Earrings 925 Sterling Silver Plated Crystal Drop Dangle Silver 432169747840
  754. Silvine Kids Language Book A5 EX214 Pack of 132512883039
  755. RHADOO SEMANTICS EP 2PK LP vinyl BRAND NEW 163445572198
  756. English Bulldog Charm Bead for Bracelet I Love 173167807700
  757. Leonard Cohen The Complete Review DVD 2012 253257541177
  758. Bristol Blue glass 2 332886335046
  759. West Side Story 50th Anniversary Edition 2013 REGION 371819883428
  760. 9H Super Hydrophobic Car Care Glass Coating Liquid 253704210319
  761. Grip Seal Bags Self Resealable Mini Grip Poly 550438993844
  762. NIB Disney Frozen Princess Anna 25 Piece Magnetic Wooden 233046130380
  763. Celtic Necklace stainless steel chain Solid 925 pendant 132670767524
  764. Ford Transit Custom Seat Covers Set Premium Comfort 400813383254
  765. Non Slip Socks Warm Children Girls Slipper Fluffy Bed 511459503072
  766. M22 WJ2V Switch joystick 1 position 22mm black Illumin none 202413491276
  767. Citroen decals x 2 van window graphics Berlingo 192772129588
  768. HP 15 AY037NC Laptop Hinges Brackets Left Right 153174613040
  769. Women Nightgown Crotchlace Bodysuit Lingerie Set Sexy Underwear 462746080777
  770. New Genuine AJP Adaptor For HP ENVY 6 1018TX 191960597072
  771. Cylinder Base Gasket Yamaha FZ1 1000 S GT 362287680732
  772. The bears and I Raising three cubs in 312174618479
  773. Garden DIY Plastic Path Maker Model Concrete Stepping 372390679866
  774. 10 x Solalite Decorative Garden Solar Lights Weatherproof 302967111179
  775. i TO FIT A MITSUBISHI SHOGUN CAR 272798258224
  776. 4x steel wheels AUDI TT Roadster 8N 205 55 123540253785
  777. Daelim ST 250 Sector Quad 2005 CC 390479267424
  778. Portable Case With Shoulder Strap For Sony DSC H400 141853597324
  779. Zapf Creation Baby Born Doll Deluxe Summer Dress 153309199954
  780. New Lambretta Scooter 200Cc Complete Engine Gasket Kit 362511182069
  781. Front And Rear Pads For Opel Vectra 30 232503743449
  782. Sterling Silver Hook Shop Til You Drop Shopping 382655056430
  783. Training Football Size 4 Blue yellow Multi Buy Of 323551214861
  784. NFL Arian Foster Houston Texans Authentic American Football 451119297690
  785. Drive Belt Gates Boost Dn Piaggio Beverly 500 401374716002
  786. Sense ESSENTIAL OILS Pure Natural Premium Aromatherapy Mood 492566155401
  787. MTG Magic the Gathering Cards GRIMCLAW BATS x2 231140990676
  788. The Spy House Large Print A Spycatcher Novel 232749275444
  789. Valentines Sexy Sissy Lady Lingerie Underwear Body Stocking One 453018253927
  790. 6x Savvies Screen Protector for Huawei Activa 4G 192015278900
  791. Deep Madness Investigator Pledge Deluxe Expansions Kickstarter 233037181924
  792. Look Keo Blade 2 Cro Mo Pedals Including Cleats 202379788201
  793. Sports Fitness Tracker Watch Waterproof Heart Rate Activity 690915535530
  794. Fashion S SHOCK Watch Sport Quartz Wrist Kid 563215566851
  795. V494 DigiprogIII Digiprog3 OBD2 Auto dodom%C3%A8ter Progarmmeur 123286334418
  796. Passenger Side Aero Blade 18 Fits Nissan Stanza 332592546693
  797. 40 XL Large Cardboard ECONOMY Box House Moving 631016507935
  798. Spectacular Spider Man Season 1 Marvel Ani DVD 273421012614
  799. Sara Miller Greeting Card Occasions sympathy new home 372016399647
  800. Ergonomics Mouse 5500dpi 7 Buttons USB Wired Optical 332254738761
  801. Doctor Who Cosmos Poster 220 Official 61 132545660952
  802. MTH 80 2172 0 GP 35 Diesel DCC Ready 192566969272
  803. 86 06 Kawasaki Vulcan 750 Engine Starting Starter Motor 352155918580
  804. Christmas Printed Pyjamas Family Matching Adult Kids PJs 563374325263
  805. Stunning Embroidered Embellhished Miss Selfridge Lbd Black Dress 153291034783
  806. Suspension System Air Compressor Pump For BMW 5 223281159304
  807. Death The Sandman DC Funko Pop Heroes 142817584001
  808. Audi TT RS Coche el%C3%A9ctrico infantil Dos Motores 183399054152
  809. Charger Adapter for HP Pavilion DM1 4400 DV4 5008TX 182947005102
  810. Baby Girl Christmas Unicorn Headband Hair Band Glitter 430872609873
  811. New Shockproof Hybrid Tempered GLASS BACK Case Cover 113393179767
  812. Jcb 6W 40W 10W 60W 15W 100W Led Gls Lamp Bc 541283542577
  813. New HP Compaq 15 R003NE Laptop Notebook Purple Lid Back 332416701705
  814. Banger Sisters Region 2 DVD sealed 163438144174
  815. Britians Hereford Cattle 143060349935
  816. GHOSTBUSTERS Special Pack 4er Premium Actionfigur Set Venkman 232696730488
  817. Letters from the Palazzo Barbaro by Henry James 362486024475
  818. Arsenal 2012 13 NIKE EPL Remembrance vs Fulham Long sleeve 413157214633
  819. 5 Pack Clear Tablet Screen Protector For 292811226562
  820. 1pcs M topaz Gemstone Loose bead 15 Strand 591647528663
  821. Beethoven Symphony 9 Choral CD 253435284831
  822. 2008 Kia Carens 20 Crdi Gs 7 Seats 172990392183
  823. PACK OF 2 Victoria%E2%80%99s Secret STRAWBERRIES CHAMPAGNE 264054655108
  824. Bloc Party Silent Alarm Vinyl LP New 2018 382632979060
  825. 9 Cell Battery for ACER Aspire AL10B31 AL10A31 Happy 271882768365
  826. Arrow Kit Silencer Thunder Aluminium Kat Ktm Duke 112760882764
  827. Gates Alternator Fan V Ribbed Drive Belt 6PK1835XS 173504448879
  828. Us Army Jungle Boots Panama Boots Vietnam Olive 123275563796
  829. 36W 12 LED UV Lamp Gel Polish Curing 332928011773
  830. Asbury Park New Jersey c1910 Postcard Ocean Front 391867703417
  831. Small vintage brass metal bell Welsh traditional costume 273622009169
  832. Fly Racing 2019 Kinetic Noiz Motocross Jersey 192634277466
  833. Timing Belt Kit Water Pump Set Cam GATES 202522470542
  834. Women Ladies Casual Sneakers Sports Athletic Leisure Running 423797718727
  835. Beethoven Symphonies Nos 13 Piano Transcriptions FRANZ 283291026847
  836. 1x YoYo Flashing Glow Colorful Yo Yo Spinner Top 401638618923
  837. 2015 Volvo V40 Cross Country 20 D2 Lux 273381441876
  838. Christmas Birthday Personalised large photo album 6x4 x 282187766147
  839. Mixed Size Mink Individual False Eyelashes Fake Lash 470657151003
  840. Replacement Dell 195v 334a PA12 UK Laptop Power 182281893784
  841. Peeking Red Card SECRET RARE 169 156 EN 263659217182
  842. Handmade Paper Cut Dancing Fairy B Large 143067892828
  843. Disney Store Lady And The Tramp Plush 303004367148
  844. PULP FICTION Movie PHOTO Print POSTER Film Art 431917221301
  845. Mapco Washer Pump for Windscreen Cleaning 90520 for 262901202012
  846. New Fashion Lady Womens Hair Flower Clip Bridal 452842497709
  847. Fluorescent Forest Banner Backdrop Event Portrait Photography Background 273191267351
  848. Mini Nano V30 ATmega328P ATmega168P CH340G FT232 33 5V micro controller NEW 502483407330
  849. Pair of Rams horns 283270064106
  850. Ty Beanie Babies VERY RARE WITH ERRORS Tush 172863440629
  851. Genuine Delta Toshiba Psc08E 01X00Nn5 65W Ac Laptop Adapter 321783425000
  852. Can I Let You Go A heartbreaking true 382149354443
  853. George V Solid Silver Cream milk Jug Sugar Bowl 254034916505
  854. The Strand Magazine July 1892 Jules Verne Rare 253955539591
  855. Red Stitch Carbon Fiber Vinyl Gear Gaiter Fits 352036220876
  856. Book Style Leather Folio Protected Case Cover For 462780043745
  857. Doctor Who Poster Plastic Frame Orange 36x24inches 254024430882
  858. Womens Short Sleeve Scoop Neck Cat Print Casual 553043535874
  859. 5XAir Acoustic Tube Earpiece Mic Headset PTT for 123200297920
  860. GATES TIMING BELT Part No 5651XS 302006502649
  861. HERONS Vegetable Garden PREMIUM HAY SUPPLEMENT GUINEA 521829970386
  862. Ford Fiesta MK5 Hatch Bosch Aerotwin Retro Front 292195084908
  863. Musicians Institute BOOK NEW 352547162308
  864. 4 x Winnie the Pooh Ladybird Books 352533480802
  865. vauxhall insignia 201119 cdti automatic mileage 48400 on 163426337400
  866. 1 100 Chair Covers Spandex Lycra Slip Seat Cover 502556731686
  867. Personalised Girl boy Wooden Christening new Born Keepsake memory Box 302698490558
  868. Rhodiola Rosea Extract 3 Rosavins Veg 500mg Capsules 222749196775
  869. 4X2 Pcs Spring Loaded Gate Silver Tone Aluminum 273567771279
  870. BMW i8 CHROME Personalised Name Toy Car MODEL 112277391221
  871. DEWALT DCK383P2T 18Volt Triple SET Combi Drill Impact 323546632148
  872. The Wire Magazine 365 July 2014 ADVENTURES IN 272937572224
  873. Wild Hogs DVD 273571901255
  874. Draculas Guest and Other Weird Tales by Bram 223165072362
  875. 512309 Moneda Plautilla Denarius Rome MBC Plata RIC363 323577547755
  876. 3x Optical End Stop Endstop Limit Switch Cable 123536719529
  877. 82mm Camera Snap on Front Lens Cap Cover For 263706385733
  878. 2 Vintage Barbie Dolls barbie outfit and blue 401642419906
  879. Triumph Trophy 900 Oxford Motorcycle Handlebar Hand Guards 263797501272
  880. EBC REAR DISCS AND GREENSTUFF PADS 276mm FOR 111934162126
  881. Katrin 344013 Plus luxury Interleaved One Stop hand 263815900331
  882. 2 Piece GEOCEL TOP GUN GLAZING PUTTY WHITE 162906711311
  883. Personalised PHOTO KEYRING Metal Oblong Shaped With Your 192653499360
  884. Disney Mens Alice In Wonderland Circle T Shirt 583696101305
  885. No Pull Small Dog Pet Cat Fleece 192670695390
  886. Canterbury Vaposhield Zip Thru Hoody Pale Grey 192358350906
  887. For Nissan Nats Almera Primera Micra X Trail Navara 332907189198
  888. 3 x WYNNS HYDRAULIC VALVE LIFTER TREATMENT OIL 132710213737
  889. Bunty The Book for Girls 1973 382697437594
  890. Lot PC Dell 7010 SFF Core I5 2400 302975373073
  891. GB 2003 Secret of Life Buckingham Palace cds 153293986914
  892. Paparazzi Headband new YELLOW PURPLE FEATHER W RHINESTONE 253927064674
  893. Boohoo Womens Fleece Side Stripe Lounge Set 183600342642
  894. Dronco Stone Cutting Discs 125mm by 3mm 182061930370
  895. UK Womens Dog Breed Print Scarf ladies printed 562566424121
  896. All Balls Fork Oil Dust Seal Kit 192766683491
  897. Old Tibetan Buddhism Temple Bronze Guru Padmasambhava Rinpoche 123542571232
  898. Steel Core Aluminum Alloy Wound Violin 4 Strings 232848795965
  899. Foundation and Empire The Foundation Series Isaac Asimov 352124375485
  900. Genuine LINKS OF LONDON 925 sterling silver BALLET 264053104745
  901. The Princess And The Frog DVD 2010 152921076234
  902. QA FM Vehicle Interior Sun Visor Buckle Clip 132833788762
  903. Belgian Belgium International Football Logo Crest Enamel 273624771565
  904. Laptop Lcd Screen For Chi Mei N156Bge L11 Revc2 321618218584
  905. SUN SHADE Wind Deflectors FORD KUGA mk1 283081509795
  906. Doctor Who Magazine Winter Special 1986 292754134898
  907. Styno Home Bank Desk Table Black Ink 05mm 113120353296
  908. Great Britain 1 2 Crown 1883 F VF silver KM754 371289839357
  909. 2004 VOLKSWAGEN GOLF V6 4MOTION 4 DOOR METALLIC 254049011739
  910. The Party Animals Greatest Hits Underground Anthems 392087504322
  911. kenwood ktld60x15 tall fridge 113369274303
  912. LEOPARD MENS Black Motorcycle Rain Coat Motorbike Over 292838824327
  913. Ladies Jewellery 925 Sterling Silver Crystal Love Magic 511084951575
  914. NEW Singer Sewing Co 7258CL Stylist 7258 Electric 153316821188
  915. SuperATV John Deere Gator 625i 825i 855D 2 Lift 302333799641
  916. adidas Neo Park ST Mens Trainers Shoes 382260554913
  917. 4x alloy wheels RENAULT Clio R 185 65 R15 152605807486
  918. 20 Pcs Car Brake Line Hose Pipe Fastener 232864793661
  919. Whiskey Silicon Ice Cube Ball Maker Mold Sphere 423370319411
  920. Mary Janes T Bar Stilettos Heels Lolita Ladies 253995787415
  921. Fram PH10267 LCV Oil Filter Replaces 2354600 361506908207
  922. EVGA Nvidia Geforce GTX 560 SC 1 GB 223166709650
  923. 2012 Suzuki Jimny 1998 On Axle Casing Front 283312268964
  924. Personalised Name Spiderman Mug Birthday Christmas Special Gift 171305996394
  925. Case For iPhone XS MAX 8 7 6s 183484699092
  926. %E2%9D%84%E2%9D%84New S MAX MARA Reversible CUBE Over Coat 263820566179
  927. 10 Chaos Space Marine Nurgle Poxwalkers Warhammer 40000 392193662266
  928. 12V Mains Apd Q031359 Psu Part Ac Adaptor 292787743631
  929. Easiest Keyboard Collection Hot Hits by Various 9781783059461 151828136840
  930. 5x HP iPAQ Extended Battery for HX2100 HX2400 131911518583
  931. 1985 Honda VF500 VF 500 F Interceptor Starter 361480862099
  932. Picture Postcard OKADA AIR BOEING 747 5N GAB 292870948990
  933. Cross Pendant Necklace Silver Stainless Steel Unisexs Chain 553012655317
  934. Pedestal Lamp in Black and Gold Cream and 261591572100
  935. Canna Terra Vega 1Litre 123550383457
  936. KENRO Slip in IVORY Quality Presentation Folder Mounts 6x4 253715078625
  937. 1996 mexico precolumbian master of the limes 1 4 273622154306
  938. Whiz 80 vintage comics in pdf formats on 113176076805
  939. San Francisco Ca aerial View Golden Gate Bridge 392201461907
  940. Snow White Girls Fancy Dress Winter Wonderland Disney 552020321294
  941. Personalised Floral Marble Romantic Gold Plastic Clear Phone 502465544121
  942. Adjustable Nylon Mesh Pet Dog Puppy Collar Padded 424018441071
  943. Service Kit Opel Vauxhall Corsa D Mk3 16 382545915649
  944. Stihl Battery Operated Toy Chainsaw Keyring 0464 113 0000 143056409087
  945. LED COB Pen Flashlight Hand Torch Lamp Magnet 432091376491
  946. Baby Driver IL genio della fuga DVD di Edgar 123535377978
  947. Justice League 1 Jim Lee Pencils Only Virgin 401618024973
  948. 4 Tickets The Washington Ballet The Nutcracker 12 24 382434155908
  949. American Pie Reunion DVD 2012E0526 202480079794
  950. Holly Berry Wreath Metal Plaque Christmas Tin Sign 401431761646
  951. Gas Mask Keyring Souvenir Gift Key Chain Ring 382539734357
  952. New Genuine Adapter for HP Pavilion X360 11 K134TU 202278793701
  953. Ladies High Roll Polo Neck Knitted Ribbed Jumper 601779969871
  954. Call of Duty Black Ops Xbox 360 392122977763
  955. THE GREAT ESCAPE personally signed 361490463239
  956. Playmates Toys Star Trek Alien Series Borg 273621515567
  957. Suspension Arm Bush Front for SEAT ALTEA 12 372458035123
  958. Raob Jewel 312407368708
  959. Mink Blink Lashes Tray Lash B C D 392160977163
  960. Vitamin E 400iu 240 Capsules Cod Liver 191583076418
  961. Antique Chinese Mandarin teacup teabowl and saucer Qianlong 232898067984
  962. Quality 4mm Leather Cloth Overstitch Wheel Roulette Spacer 152986766666
  963. Birds of Prey Batman The Complete Series DVD 202343428173
  964. CAMSHAFT PULLEY 2154011 RENAULT LATITUDE 15 dCi LOGAN 202541376218
  965. Benin 2011 MNH Prince William Kate Royal 273517113294
  966. 12V YAMAHA PSR 185 PSR 500M PSS 150 KEYBOARD AC DC Switching 311945371718
  967. Microsoft Lumia 950 Leather Wallet Case 531173696421
  968. Disney Lion King Mug Simba Timon and 264088117663
  969. 2014 Volkswagen Caddy Maxi C20 Tdi Kombi Mpv 323462054165
  970. Anatomie Poster Kunststoff Rahmen Weiss 91x61cm AN4YY 401649582040
  971. The Simpsons 3 D Chess Set King 3 192756367403
  972. Subaru Legacy X 4 Cam 89 99 Heavy Duty 272841534654
  973. Wide Angle Easy View Rear Baby Child Back 232971754266
  974. 90Amp Replacement Premium Alternator for Skoda Octavia 18 332962724222
  975. C Vintage Tiny 5cm 2 Akta Dalahemslojd Swedish Dala 292801337202
  976. 925 Sterling Silver Stud Earrings Crystal Pearl Style 512506105691
  977. Front Vented Brake Discs Citroen C4 16 16V 401650263220
  978. London Essential Streetfinder Atlas Collins Travel Guides By 292744836053
  979. VW Caddy Maxi Van OCT 2010 to JUN 152769056395
  980. Vintage Blue Guitar In Forest Music Box Mounted 461949650599
  981. Marks and Spencer Marie Chantal 6 9 months baby girl 173700522755
  982. 1GB RAM Memory HP Compaq Presario SR5120LA DDR2 5300 292701737212
  983. LC HK 7 Pcs Set Pro Eyeshadow Foundation Blush 552548225499
  984. Brand NEW Barbie Careers Dentist Playset Dolls Accessories 332864478444
  985. Kenda Honey Badger Tubeless Ready SCT MTB Mountain 362443632286
  986. 17 inch Laptop Sleeve Bag Case Cover For 282183198827
  987. QSP Oil Filter Cartridge for Audi Q5 2008 132217970386
  988. Merry Christmas Photography Vinyl Backdrop Baby Photo Background 573019672680
  989. Peugeot 108 15%E2%80%9D Space Saver Spare Wheel 254003982240
  990. BOSCH Timing Cam Belt Kit Fits Alfa Romeo 131269419958
  991. Infant Toddler Baby Boy Girl Warm Snow Boots 542017675228
  992. Waterproof Shockproof Metal Aluminum Gorilla Case For iPhone 413665192165
  993. New Silver HP 15 AC648TX Laptop Screen Case Top 253647268373
  994. Vauxhall Astra F Mk3 Hatchback 8 1994 1998 Lever Wing 332255839538
  995. Julie Newmar as CATWOMAN Authentic Hand Signed Autograph 173694707222
  996. Star Wars The Clone Wars Anakin Skywalker Figure 303001839448
  997. NEW Pandora Sterling Silver ALE S 925 Horse 122793556625
  998. The Anguished Dawn by Hogan James P Paperback 392078393352
  999. Adults 1920S Vintage Style Flapper Gangster Black Cigarette 192672270674
  1000. SKI SNOWBAORD Datawax Universal High Performance 254023786032
  1001. Paracord Survival Bracelet Whistle Flint Scraper Fire Starter 302513714276
  1002. Ladies Top Tshirt Bundle Size S 8 10 303004562673
  1003. steel wheels SKODA OCTAVIA Combi 20 TDI 16V 153289932086
  1004. 360 Whipped Cream Chargers Canisters 8g Pure Nitrous 192256848470
  1005. UK Rechargeable 12000LM T6 3x CREE LED Headlamp 223254037883
  1006. Codex Space Marines Primaris Edition ENGLISH Warhammer 40000 323000206291
  1007. Vintage Stoneware Moss Green Small Studio Pottery Ceramic 192399703740
  1008. Choose Life T Shirt Wham George Michael Inspired 80s 580982074461
  1009. 100 Waterproof Vw Transporter T5 Van Seat 251563351850
  1010. 10 20 30 60 Large Microfibre Cleaning Cloths Car Detailing Polishing 432046626666
  1011. 4 Corelle TIMBER SHADOWS Acrylic DRINKWARE Beverage Glass 162290410510
  1012. RARE Ty Beanie Boo Boos Soft Toy 233023384366
  1013. 50Cm Swirl Round Wall Mirror Silver Black Gold 282858350276
  1014. 2004 Leon cupra 17Alloy Wheels Tyres 5x100 292833562637
  1015. SONIA Listen To Your Heart Scarce 230987553517
  1016. 2GB RAM Memory Advent 8212 DDR2 4200 Laptop Memory 113224385280
  1017. Antique 1800s Girard Wrench Co 12 Adjustable Screw 223272190400
  1018. pirates of the caribbean Johny Depp Signed Poster 273586370922
  1019. MR ROBOT SEASON 2 3PC MR ROBOT 113469921424
  1020. AURAGLOW Plug Play Fire Rated IP65 8w 490755549628
  1021. 13X for Childrens Pizza Slices Cola Ice Cream 192762321049
  1022. CCleaner Professional 2018 for Windows Build Lifetime Activated 223221050160
  1023. Wardrobe VERONA 4 250 Sliding Doors Hanging Rails Shelves 173417431555
  1024. New Women Ladies Black Floral Pattern Tights 382637428806
  1025. Mars Attacks Occupation 4A VF NM IDW save 312363054308
  1026. New Modern Tv Stand Tv Unit With Free 561851288437
  1027. Blue Print V Ribbed Belt AD07R1590 163402050021
  1028. Chinese Deer H0rn Rare Collectible Handwork Carved Golden 401667400521
  1029. Original Old Antique Print 1878 Tell Men Young 352529442134
  1030. Jason Isaacs Signed A4 Framed Photo Display Star 352396773512
  1031. Blue Print Fuel Filter ADV182306 BRAND NEW 153063017702
  1032. Pokemon Darkrai EX 74 122 XY 123387495817
  1033. 65 8 10%E2%80%9C Electric Smart Self Balancing Scooters Hover Bluetooth 591588505728
  1034. NEW Royal Doulton Charlene Mullen London Calling Set 283270371505
  1035. The Jackie Robinson Story Film On DVD Jackie 232963069076
  1036. Carl Zeiss Planar T 50Mm F 17 C y Contax yashica 332970020974
  1037. Dead Island PS3 Disc Only 142997332836
  1038. Kustom Kit Men Casual Wear Short Sleeved T Shirt 601868895116
  1039. 2016 Chic Grass Mud Horse Llama Alpaca Sheep 620607631331
  1040. GUND Beatrix Potter Peter Rabbit Plush Small NEW 323613573748
  1041. Nerf Raider Cs 35 Stockade Rampage Boxed Darts Vgc 512486983686
  1042. Removable Adjustable Computer Desk Laptop Table Sofa Tray 183541128515
  1043. The Princess Bride Special Edition NEW 202430768666
  1044. Solid 14K Yellow Gold 1 10mm Rope Chain Link 512598690133
  1045. Metal Cutting Dies Stencil Scrapbook Paper Cards Craft 572759027058
  1046. Infinity In The Palm Of Your Hand 273532202771
  1047. Lens Hood Metal Universal 77mm silver for Nikon 283292268155
  1048. ta Vintage Paperback Booklet Evenrude Boating Log and 122958190011
  1049. Salute 1 Audio CD 192474642011
  1050. Batman Joker The Killing Joke Borderless Many Sizes 141952327770
  1051. Necklace Short Gold Grey Crystal Big Round Circle 253051757412
  1052. Volkswagon Phaeton 30 TDI Auto 4 Motion 292848504743
  1053. Makita HR166DSMJ 108v CXT Slide SDS Plus Hammer 132729436711
  1054. Fashion Women Handbag Shoulder Bag Backback Large Tote 273607294865
  1055. denby storm footed mug 283277766033
  1056. The Littlest Christmas Tree by Herman R A 143054803684
  1057. Aria Pro Ii Cat Electric Bass Guitar 233049458903
  1058. Marvel Generation Next 1995 X Men Age Of Apocalypse 264085663737
  1059. Silver Cross Ranger Jnr Dolls Pram with 183591580342
  1060. New Walk In Shower Enclosure 8mm Easyclean Glass 471766507891
  1061. 10 40Pcs 38mm Chandelier Glass Crystal Lamp Prism Part 661099550854
  1062. KF Concept M42 to Leica M Adapter M42 202537911189
  1063. Baby set NEWBORN Hand Knitted GIRLS Beanie Cardigan Boots Various Colours 432106995115
  1064. Cool Key Chain Ring Mens Women Creative Alloy 461157208622
  1065. Case for Apple iPhone Cover Real Genuine Leather 553239100179
  1066. Charger Adapter for HP Compaq Presario V2366AP 182946996884
  1067. Disney Mickey Minnie Mouse Stitch More 452770739870
  1068. Pug Print Fancy Women Printed Ladies Large Scarf 581882416808
  1069. Motorcycle Windscreen Windshield For Suzuki GSXR 1000 K7 183194769331
  1070. Baithak Gana Queen Motimala Bholasing Binda 143054463980
  1071. Triumph TR2 Badge Logo Metal Sign 15x12cm NOT 223275824217
  1072. Red Wolf 1 Hip Hop Variant Marvel Comics 302616701507
  1073. 900W GASOLINE CHAINSAW MACHINE CUTTING WOOD 254CC 3000r min 173690762073
  1074. TAKE THAT GREATEST HITS BEST OF CD 302964540360
  1075. KFD 12V 2000mA 2A AC 230V to DC 123560476925
  1076. Extended Edition The Hobbit The Desolation 223293306373
  1077. SWAG Disc Brake Pad Set Front Axle Fits 132266463831
  1078. 5 Inch Wide Frame Wall Mirror Full 640015093829
  1079. We Can Be Heroes Chris Lilley Australia Region 202122441516
  1080. Vw Golf Jetta Caddy Mk1 And Cabrio Sportline 132899615873
  1081. The Indoor Gardener Creative Designs for Plants in 232914602941
  1082. New Sealed in Box Samsung Galaxy A5 A500F 563344384014
  1083. AMAZING SPIDER MAN 800 John Romita Sr Variant 183245765174
  1084. Liquid Bottles Empty Plastic PET Bottle 30ml 50ml 572031429323
  1085. Nikon AF S DX NIKKOR 17 55mm f 28G IF ED Zoom 233009794448
  1086. 4x Reusable Coffee Capsules Cup Filter For Dolce 223016776848
  1087. RG Number Plate Holder LED Indicators KTM 183415932751
  1088. Volkswagen Polo 2016 12 TSI Match 5dr Hatchback 323511529854
  1089. Bayonetta Microsoft Xbox 360 Brand New Sealed 232872225293
  1090. Volkswagen Golf S PETROL MANUAL 2003 03 312388544108
  1091. Door Wall Mounted Pot Pan Lid Storage Saucepan 302919812362
  1092. E14 to E27 Extend Base LED CFL Light 183318050761
  1093. Ignition Coil Mazda 1300 1970 1978 13L 142546791289
  1094. SCS Swarovski Austrian Crystal Faceted Ball Paperweight 132543924262
  1095. Noise Cancelling Earplugs for Concerts Musicians cycles Hearing 553334245133
  1096. Arma 3 Marksmen DLC PC STEAM CD KEY %F0%9F%94%91%F0%9F%95%B9%F0%9F%8E%AE 222998210883
  1097. Yamaha XT 600 EH 2000 2001 EBC Clutch Plate 401218915430
  1098. Gem Unc Bi Metal Ecuador 1997 100 Sucres 70th Anniversary 323494013758
  1099. Sachs 2x Shock Absorbers Dampers Pair Front kit 232779347235
  1100. Wooden Train New Fashion Whistle Locomotive Sound Warning 392177542062
  1101. LED Raindrop Teardrop Solar Powered String Fairy Lights 552993997844
  1102. New NGK Ignition Coil For AUDI TT 8J 361291427031
  1103. In My Life The Beatles Black Heart Quote 183483461716
  1104. 2007 TOYOTA AURIS Mk1 E150 16 Petrol Engine 352282441092
  1105. Electric Window Control Power Switch Push Button Fits 282857951018
  1106. 1080P Wireless Wifi IP Camera CCTV IR Surveillance 532556465109
  1107. Clear Polythene Clothes Covers Garment Storage Protector Dry 451730130038
  1108. Headlamp Headlight Right O S Driver Side Toyota Yaris Vitz 232569969032
  1109. mcafee internet security 2018 anti virus software 1 362002438459
  1110. Rare fifty pence Potter 50p Coins Jemima Puddle 572634959050
  1111. Tiger Woods PGA Tour 09 Xbox 360 VideoGames 382499503279
  1112. Cooksmart Double Oven Glove Kitchen Cooking Oven Mitts 563462513776
  1113. Arch Support Shoe Inserts Gel Insoles Orthotic Shoes 552095876483
  1114. 2016 Fiat Panda 09 Twinair 4X4 382592619614
  1115. Wrist Elbow Knee Pad Children Kids Protectors Skating 423809726527
  1116. Packs of EVEREADY LED GLS Lamps B22 512539726101
  1117. Auth Vintage Omega Silver Dial DayDate Cal750 Automatic 223290343318
  1118. Audi A6 Saloon Boot Liner 2011 2017 462644881657
  1119. Ex Police Womens Lightweight Uniform Trousers Smart Trousers 641087134268
  1120. 112 Scale Natural Wood Finish Staircase Dolls House 162938845057
  1121. 4pcs Women Night Sleep Hat Long Hair Care 311968215275
  1122. Wedgwood Mirabelle bone china 5 piece Place Setting FREE 153280800140
  1123. PERSONALISED PRINCESS CUSTOM NAME baby girl fairy wall 600040385606
  1124. Bundle of 5 Cute Baby Hats for 6 12 264051455133
  1125. Art Deco Lady Lamp Globe in Striking Water 163412509065
  1126. New T6 Waterproof 18650 Led Flashlight Torch Cree 123498246876
  1127. High Quality Car Floor Mats Set In Black White 222672642125
  1128. Silcare Color It PREMIUM UV LED Gel Nail 451920571579
  1129. Peugeot 206 1998 2009 Rear Hub Wheel Bearing Kit 331969489450
  1130. %E2%9D%A4 Toy Kids The Broken Token Box Organizer 143024576525
  1131. Firestorm Vol 4 the Fury of 283209137695
  1132. Aoshima 1 43 Delorean Back To The Future Part 312358478323
  1133. 04788 Gram Alaska Natural Gold Nugget 29681 273615738583
  1134. The Hunger Games Catching Fire Collectors Edition Blu Ray 372508563252
  1135. Wk49 Batman Vol 3 60B Variant 362498625261
  1136. Samsung 26%E2%80%9D Tv 183599293267
  1137. New wall Garden Porch UpDown Lights IP44 262986543350
  1138. BESTRUNNER 1 32GB 64 512MB USB 20 Flash Memory Stick 453148697791
  1139. Disney Cars Diecast lightning mcqueen piston cup 382696559481
  1140. New Mens Timberland Brown Larchmont Chukka Leather Boots 112650813713
  1141. Airfix A68206 Supermarine Spitfire Aeroplane MkIa 172 With 233069614694
  1142. 20L Black Plastic Fuel Jerry Can Diesel Petrol 162607647057
  1143. Dell Latitude E6230 Core i5 CPU 4GB RAM 582252703141
  1144. steel wheels ALFA ROMEO 156 Sportwagon 932 185 65 123540378745
  1145. DVD HOTEL RWANDA Don Cheadle 283307874980
  1146. Oil Filter for FORDMAZDA RANGERETWLAABT 50 PickupCDUNWLAT FILTRON OP6751 113371307086
  1147. Elgar Enigma Variations Vaughan Williams Symphony No 303003260909
  1148. Aprilia Tuareg Wind 600cc 1989 0600 CC 400403500178
  1149. coco chanel pink roses perfume bottle with flowers 273515283084
  1150. 2x Chevrolet Cruze Genuine Osram Ultra Life Side 362297724071
  1151. GB GUERNSEY 1997 Europa 97 Tales Legends Victor 352540100440
  1152. 2014 64 Volkswagen Transporter 20 T28 Tdi P v 254006496722
  1153. 1x psyker imperial guard gw games workshop 112396983887
  1154. JT Rear Sprocket 44T 530P High Carbon Steel 273570787468
  1155. Adult Karting Kart Race Rally suits Adult Poly cotton One Piece 562614916962
  1156. Audi TTS 2010 To 2014 O S Right Front 282483888576
  1157. Dancer Image 1 2012 NM Stock Image 132870821565
  1158. Gone In 60 Seconds Nicolas Cage 283279518180
  1159. Barry Gibb In the Now 2016 183266082838
  1160. 5X6 cell Battery for ACER Aspire ONE 522 D255 273576527149
  1161. New The Matchmaker Hilderbrand Elin Book 323570724081
  1162. The Happy Prince with Rupert Everett New 223190089234
  1163. SOCOFY Women Printing Splicing Handmade Flower Sandal Flat 302984439469
  1164. Monster High Ghouls Rule Cleo De Nile With 132875315736
  1165. Doctor Who Christmas Special 2017 Twice Upon 253970631438
  1166. 425 Elijah Cotton Ltd Beaker Coronation Of 312035464781
  1167. Destiny 2 Standard PlayStation 4 VideoGames 302462074592
  1168. Mercedes C Class Saloon W204 Driver Rear Door 142745673143
  1169. Delay Cream Enhancer Orgasm Long Act 50ml 191923294007
  1170. Orange Stitch For Bmw 3 Series E46 99 05 391873873450
  1171. LOOK As Dug Elizabeth 11 and George V1 292877933922
  1172. Bargain from 99p Vertical blinds replacement SLATS Louvres 173232608592
  1173. Cartridge Canon not OEM Pixma PGI525 CLI526 PGI520 CLI521 PGI550 CLI551 591465740070
  1174. Anarkali salwar kameez suit Ethnic pakistani Bollywood Designer 253866730566
  1175. 371140000 KIT TRASMISSIONE DID APRILIA Pegaso 1991 600CC 152816773438
  1176. GIFT ITEM Collection Music Video Photo 264067054043
  1177. Kids Boys Girls Storage Seat Stool Toy Books 490233188257
  1178. Mercedes Benz Vito 2006 22 Cdi Fuel Pump Bosch 332882143490
  1179. Kids Boys Girls Storage Seat Stool Toy Books 492808185616
  1180. 2 x 2 48mm 15 x 15 631554333529
  1181. 3Ft 4Ft Led Office Pendant Light Led Tube 173521619530
  1182. Aprilia Tuareg ETX 600cc 1985 0600 CC 362165987779
  1183. Valeo Front Left Window Regulator 850656 BRAND 173638508403
  1184. Commercial 32oz Spray Bottles Foaming Cleaning Sprayer NEW 323397345355
  1185. IMASAF Exhaust System from Kat Audi 80 B4 382230514196
  1186. K Swiss Mens Adcourt Belmont Aero Lozan Retro 283201635048
  1187. Replacement 38cm 6 Sections Telescopic Antenna Aerial for 172136188086
  1188. Mens Womens Ladies Unisex Sports Athletic Hi Trainer 541972356178
  1189. Womens Choker V Holiday Long Tops T shirt Ladies 631475634069
  1190. Toddler Kid Girl Winter Warm Outwear Cloak Baby 492783551962
  1191. Vikan 0700 Nito Hose Pipe Tap Connector Quick 253071695756
  1192. Rear Wheel Bearing Kit For Ford Transit 332391425643
  1193. Universal LED Strobe Flash Light Flashing Controller for 152915455303
  1194. JT Rear Sprocket 45T 520P High Carbon Steel 283270016648
  1195. steel wheels VW Jetta VI 16 195 65 R15 153300315326
  1196. THE PUNISHER Comic Vol 2 No 331916996580
  1197. Tie Track Rod End for VAUXHALL ZAFIRA 16 371901134891
  1198. MONOBLOCK TAP BACKNUT BOX SPANNER monobloc nut 719819 362433650469
  1199. Jakks Spynet Watch 2011 w Night Vision Video 273586297241
  1200. New Genuine Aprilia Cylinder Valves Nut AP0242591 372021868094
  1201. Patterson Blick Instant retro Picture Book set x 143005244115
  1202. Vauxhall Corsa C D Astra G H Zafira 173709533135
  1203. GORILLAZ Humanz SEALED DELUXE BOX 2xLP ART 323434932939
  1204. 10x Wheel Arch Trim Clips to Fit Nissan 372276215497
  1205. Yamaha FZ8 800 NA ABS 59P2 2012 182611022529
  1206. 1990 Yamaha BW 80 Dirt Bike Namura Top 192432596289
  1207. 8 x 41mm 8 LED 3528 White SMD Festoon 401236509261
  1208. 23 09 1979 Rugby Union Programme Rugby 7s At 372532055339
  1209. Motul 5 L 5W 30 Engine Oil Mann Filter VW 401662654796
  1210. Pure 70s by Various Artists CD May 1999 PolyGram 273627779441
  1211. Ogdens Full Set Trick Billiards 50 Cards Exc 332495755091
  1212. Real Madrid Football 2018 2019 Size 5 White Panel 113370771718
  1213. Frozen Princess Doll Figures Kids Girl Cosplay Headband 521994903269
  1214. Ion Discover DJ Computer DJ System RRP %C2%A3250 272907817966
  1215. Genuine Vw Volkswagen Black Rear View Mirror Fits 202544620715
  1216. Olli Ella CO KO MICROSUADE ROCKER NATURAL Nursing 671387254988
  1217. Front Brake Pads Brembo Sintered 07Bb04Sa Husqvarna Tc 142812852661
  1218. Buena Vista Social Club At Carnegie Hall vinyl 223278055170
  1219. Brookite Telescopic Windsock Flag Pole Ground Stake 410983516749
  1220. Disneyland Resort Paris Tinkerbell 52cm Soft Toy Doll 173701132861
  1221. DC 12V 5 Pins 30A Automotive Changeover Relay 162967821413
  1222. 6 Cell Battery for Acer Aspire 4551 4741 151779215931
  1223. Sky Captain And The World Of Tomorrow DVD 192736069342
  1224. Intel Xeon Quad Core Processor E3 1240 v3 34GHz 50GT s 323618156336
  1225. YAMAHA TZR 250 1986 Ferodo Platinum Front Disc 142963742579
  1226. Dog Breeds Gate Signs Beware I Live Here 572828019204
  1227. QA Rechargeable LED Night Flashing USB Charging Pet 432035928098
  1228. For One Plus 6T 6 5T 5 3T 153257151190
  1229. UK Women Knitted V Neck Jumper Sexy Ladies 522024295025
  1230. Intel Xeon e3 1220 V2 31 Ghz CPU Processor 113488262316
  1231. Hawa Baal Semi Sterling Silver Ball Nose Hoop 431335994019
  1232. steel wheels VW Polo 9N 165 70 R14 81T 153094646336
  1233. Che Guevara Mens T Shirt Military Image 570996738250
  1234. Lagenlook Italian 95 Cotton Dress long Top 7 Colours 441932796140
  1235. Boston Taupe Brown Stone Effect Satin Glazed Ceramic 192715802965
  1236. GB Presentation Pack %E2%80%9CEngland A British Journey%E2%80%9D 183265526450
  1237. ROLLING STONES BEGGARS BANQUET LONDON LAX 1012 Japan VINYL 332950862589
  1238. UNCANNY X MEN 144 GOOD1981Chris ClaremontBargain 302968339643
  1239. Vintage Retro Cat Eye Rhinestone Sunglasses Womens Eyewear 601878536881
  1240. buy 2 Get 1 Free Kabbalah Red cord 263977327654
  1241. 3 x Kodak Portra 400 120 Roll 292044304852
  1242. 07Bb12Tt Rear Brake Pads Brembo Rieju Tango 2007 272830903023
  1243. Duvet Cover Quilt Covers Luxury Percale Bedding Set 553301062848
  1244. 18 3SDM 005 BLACK alloy wheels audi a3 292155473512
  1245. UK Christmas Kids Newborn Baby Girl Romper Bow Skirt 690888826626
  1246. Vans Sk8 Hi Grey 123261724401
  1247. Solar Powered LED Security Wall Light PIR Motion 553155485831
  1248. Little Red Tractor Winter Lights Lets Go Glorious Mud DVD 362509418204
  1249. Joules Rudy Reindeer Sleeve Jumper in NAVY REINDEER 302990904643
  1250. Black Beret Hat Plain Wool Autumn Women Girls 563528080685
  1251. Simon Garfunkel The Complete Albums Collection 392132349620
  1252. CHUWI Hi10 101Windows 10 Android 4GB 64GB Tablet PC 583271581245
  1253. DAYCO Poly V Ribbed Belt 8 Ribs 1450mm 8PK1450HD 351714028639
  1254. Disneyland Paris Tinker bell Exclusive design Mug Green 254032166566
  1255. Personalised Embroidered Dragon Journal Diary Book of Shadows Pagan Wiccan 232803518519
  1256. ENG 047 HAND SIGNED 12x8 PHOTO ENGLAND 1954 382643191990
  1257. Womens Flat Ballet Pump Girls Jewelled Gem Work 651167465216
  1258. Storage Wheel Bearing Housing Front Left 1141100270 253045905711
  1259. 36 and 12 Pairs Girls Cotton School Socks 512454623611
  1260. VonShef Salt and Pepper Mill Grinder Shaker Spice 352553660917
  1261. The Carpenters The Nations Favorite Carpenters Songs Cd 153303350938
  1262. 15mm WW2 RuinedTerraced Houses and Shop FOW Flames 182112106963
  1263. New 50mm Professional Static Pole Dance Pole 112088988173
  1264. SOCCER Girl Monogram Bag Red Large Zipper Tote 183568647906
  1265. 2X M3 M20 05 25mm High Speed HSS Metric Left 512597489241
  1266. Dead End Drive In DVD 2013 132899832005
  1267. RESIDENT EVIL DEADLY SILENCE Nintendo DS NDS 2DS 183520803140
  1268. Bourjois Healthy Mix Foundation 30ml NEW SHAPE 581578400800
  1269. 2011 Volvo Globetrotter Xl Fh13 460 6X2 Tractor Unit 183585573785
  1270. HP 15 AC050UR 156 Rear Lid Back Cover Red Panel 202357806552
  1271. Wild Hogs Dvd 153326865404
  1272. NEW 3 Pcs HSS Steel Step Cone Drill 572947491379
  1273. Rare YUGIOH cards 11x ultimate 14x secret 19x 282521342557
  1274. 2015 Porsche Macan TURBO PDK Petrol grey Semi 223289099986
  1275. Large Vase Fruit Bowl Crystal Hand Cut XIX 272481780655
  1276. Selens GE 160 LED Video Camera Macro Ring Light 183183400227
  1277. Singer 66K Lotus Decals No2see It Sewing 183620469240
  1278. steel wheels ALFA ROMEO 156 932 185 65 R15 273606035858
  1279. NEW LARGE Interior Dehumidifier Home Portable Damp Mould 580473857145
  1280. Sharp AZURITE crystals on matrix Tsumeb Mine 192706862406
  1281. Coco No 5 Perfume Art Print Floral Art 323456821478
  1282. Vintage Camera Shoulder Neck Strap Belt for Nikon 113220031731
  1283. Hasbro Family Fun Pack Xbox One NEW 182963449756
  1284. VDO Fuel Injector Fits BMW X5 X6 Z4 162960334891
  1285. Poster Frame Photo Frames Modern Picture Frame Wood 550923052595
  1286. Scots Guards Regimental badge 163155721044
  1287. AUDI SERVICE BOOK BRAND NEW FOR ALL MODELS 173360925707
  1288. Bohemia Crystal Plain Brandy Glass With Santas Face 382452621206
  1289. Orbit Dolls House 1 12th Food Accessory Creme 273547205365
  1290. 6pcs Different Color Feather Metal Bookmarks Book Marker 113488130345
  1291. JT Rear Sprocket 45T 520P High Carbon Steel 292825784242
  1292. 1920243 Claude Debussy Complete Works For Solo Piano 183587770398
  1293. Kids and Adult Women Ballet Dance Yoga Gymnastics 572992034229
  1294. NEW Replacement 20V 325A 65W ADAPTOR POWER SUPPLY 183244147462
  1295. Solid Hard wood Mahogany display bases and plinths 141867892040
  1296. Tempered Glass Film Screen Protector For Samsung Galaxy 423771288615
  1297. Vtg Shirtwaister Midi Dress Sz 18 20 233050302703
  1298. Suzuki Swift 15 Glx 5 Dr Fsh 264003042535
  1299. Grey Shark Attack Costume Group Mens Funny Stag 142479869550
  1300. Bill Douglas Trilogy My Childhood My 163303121815
  1301. WPS Clutch Lever 30 54662 Silver 362449927220
  1302. New Genuine FEBEST Driveshaft CV Joint 0310 BE Top 192577971890
  1303. Grey Stitch Leather Automatic Gear Handbrake Gaiter For 232230999475
  1304. I Love My Mummy Funny Baby Vest Grow 582188961986
  1305. Resistance Bands Loop Set Exercise Sports Fitness Home 432199151602
  1306. Lord of the Rings Collectors model magazine %C2%A0 273586964086
  1307. Vertex Piston Kit 23653A 283285941767
  1308. Trampoline Replacement Pad Padding Safety Net Cover Ladder 480373456887
  1309. 2005 Mercedes Benz C180 Kompressor 18 Automatic Avantgarde 202548232416
  1310. Coca Cola Retro Vintage Wood Fruit Crate Wooden 292234907520
  1311. Stake Land Blu ray 2011 New and sealed 273612576353
  1312. Various %E2%80%8E%E2%80%93 Barbie Summer Hits 2005 CD Compilation 202532684903
  1313. 371128000 KIT TRASMISSIONE DID APRILIA Pegaso 1991 1992 125CC 152826458874
  1314. Pro Bolt TI Front Pinch Bolts Gold TIFAPINCH90G Honda 302733209607
  1315. Mens Red Tape Tapton Formal Smart Leather Pull 591392733974
  1316. 2006 Toyota Alphard 30 Automatic Mz G Leather Edition 163313091792
  1317. Churchills Secret DVD NEW Region 281973657057
  1318. Thomas Wylde Luxurious White Grey Butterfly Skull Print 112917070789
  1319. 6 cell Battery for ACER Aspire ONE 522 D255 253854893172
  1320. For iPhone X Xs MAX 8 7 Plus 563578894962
  1321. Sarah the Spider by Robinson Hilary Hardback Book 142693869427
  1322. EU US Plug to UK Great Britain England 323526905789
  1323. Room on the broom The Gruffalos Child 192757462222
  1324. ROLEX Mens Oyster Perpetual Date 1500 Automatic c1971 254031516983
  1325. Ford Transit Connect P65 P70 P80 18 Rear 372459806780
  1326. Official Elisabeth Fredriksson Geometric Pattern Leather Book Case 591637197434
  1327. steel wheels ALFA ROMEO 156 932 185 65 R15 273606372216
  1328. Red Stitch Leather Gear Handbrake Plastic Frame 391990665978
  1329. Percys Park After the Storm Picture Lions 382595130086
  1330. 120W 2 Way Socket Splitter Car Cigarette Lighter 581840336145
  1331. 12x LARGE INTERIOR DEHUMIDIFIER DAMP TRAP 220g 263893706734
  1332. Underworld Evolution REGION 4 DVD 273593314007
  1333. 2013 Yamaha yzf r125 Front Sprocket Cover 183595952093
  1334. Ps4 Dualshock 4 Wireless Controller Official New 312335317035
  1335. Handmade Personalised Heart %E2%80%9COur First Christmas As Mr 332487643449
  1336. FORD JEANS BLUE MET 44999 Car Aerosol 423728570543
  1337. Vintage Art Crafts Picture Frame Snake Hollow Gusher 400850939848
  1338. Claude Debussy The Complete Works 0190295736750 391971933892
  1339. 6 cell Battery for ACER Aspire ONE 522 D255 232951134426
  1340. Swivel Flash Bracket U Type Umbrella Holder 1 4 3 8 153279073428
  1341. Tall Glass Tea Light Candle Holder Votive Candle 462712080464
  1342. Stackable Storage Box Thick Boot Shoe Organizer Transparent 453198667421
  1343. FRD FRGermany 2382 2386 complete issue fine used 312388335376
  1344. 2016 50P COIN BATTLE OF HASTINGS RARE FIFTY 372533552025
  1345. DG Light Blue Eau De Toilette Gift Set 253984088600
  1346. Super Bouncy Jet Balls Ideal for Children Party 485096306547
  1347. The Complete Adventures of Charlie And Mr Willy 392114896524
  1348. Universal Auto Steering Wheel Quick Release Hub Adapter 163220534974
  1349. West Country Poster Art Calendar 2019 Travel 372282433551
  1350. Womens Ladies High Waist Flared Wide Leg Jeans 462605997494
  1351. coco chanel black noir perfume bottle print poster 462415223344
  1352. Debussy Complete Works For Piano Solo Volume III 351787342334
  1353. Samsung 1GB DDR2 PC2 6400S 800MHz Laptop Memory RAM 400956806653
  1354. Pokemon TCG Card Suicune GX 200 214 192710117922
  1355. Ice Road Truckers Season 9 DVD Region 253638327316
  1356. Officially Licensed The X Files Truth Is Out 253714690893
  1357. NEW BOXED Chad Valley Designafriend Layla Doll NEW 223264168637
  1358. Fit Mercedes Benz Cree LED Projector Car Door 453127256907
  1359. 9 Cell Battery for Acer Aspire 4551 4741 282536447454
  1360. Xmas Tree Decoration Silver Tone Heart 420738486094
  1361. 15 Days by dtp Entertainment AG Game 163413194530
  1362. 3 16 1 4 5 16 BSW Full Nuts Zinc Plated 332828677783
  1363. Game of Thrones The Complete Season 1 5 183585579337
  1364. Stylish Women PU Leather Wallet Card Holder Coin 690637607401
  1365. Telepass Holder S602 Scooter Adhesive Moto Givi Peugeot 112815090207
  1366. Lithuania T Shirt My Heart Belongs To Lithuania Country 472016569851
  1367. Mens Liverpool FC Away Shirt Medium 302045318731
  1368. Fiat Ducato 2001 Luxury Velour Heavy Duty Van 122332773037
  1369. Battery 48Wh original gray silver suitable for Toshiba Satellite 163080204369
  1370. Antique Vintage Cast Iron Paper Press 202538785891
  1371. Killzone Shadow Fall Sony PlayStation 4 2013 202552015762
  1372. For Vodafone Smart N9 Lite New Leather Wallet 563218569583
  1373. 4XUSB Handheld Wire RJ45 BNC RJ11 1394 Ethernet 323538186720
  1374. Everybody Loves Raymond The Complete Seventh Season 7 192585158215
  1375. My Little Pony Girls Sequin T Shirt 253469162120
  1376. 2 Pairs Chinese Red Chopsticks In Gift Box 401451449110
  1377. Detachable Towbar 7pin Wiring for VW Transporter 282594641748
  1378. UK Satin Mermaid Formal Wedding Dress Backless Long 273140294900
  1379. Nintendo DS replacement case with Cover Lunar Dragon 273573757751
  1380. 2018 18 plate Ford Transit 20TDCi EURO6 350 153284262799
  1381. UK Family Matching Adult Kids Baby Women Men 690747037877
  1382. RINGO STARRPHOTOGRAPHVG EX2 Track 7 Single Picture SleeveEMI RECORDS 113445006723
  1383. KT Tape Original Cotton Kinesiology Therapeutic Fitness Tape 560572871281
  1384. Universal LED LCD TV Backlit Constant Current Module 601903829870
  1385. Fancy Classic Glossy Embossed Silver Plated Napkin Rings 264002015412
  1386. Official Optimum Nutrition 100 Gold Standard Whey 227kg 690618216466
  1387. Bmw 518 520 525 535 540 535 E34 301056874736
  1388. Dvi D Male To Vga Svga Female Adapter Connector 273349900289
  1389. White Rabbit Alice Wonderland VINTAGE ENAMEL METAL TIN 412670423269
  1390. Ford Fiesta Right Driver Offside Rear Window Regulator 264014532150
  1391. Set of 5 ART PRINT of COCO CHANEL 163055934318
  1392. The Cure Greatest Hits CD Album 142968629781
  1393. Gorgeous Aromatic Hand Poured Soy Wax Melt Tart 520931651683
  1394. Sylvanian Families Replacement Spares Accessories Hammock x 132900226106
  1395. Shazalakazoo Karton City Boom Shazalakazoo CD 302854317387
  1396. Kit Viteria Yamaha Yz 450 F 2006 2009 Bolt 182219645877
  1397. Grey Leather Look Seat Covers Front Pair For 323456204997
  1398. 12 Blue Roll 2 Ply Centrefeed Tissue Roll 122319860048
  1399. for LG H650E ZERO 4G 2015 Holster Case 182581996448
  1400. Large Interior Dehumidifier Home Portable Damp Mould Mildew 382659695999
  1401. 8Pk2225Hd Dayco Drive Belt Micro V Multi Ribbed Belt 263714508360
  1402. The Walking Dead Daryl Wants You 142629311009
  1403. Jackass The Movie in Good Condition 132426481262
  1404. Welsh Crocodile Caru Chi Bampi Chrome Metal Bottle 401149415285
  1405. Vauxhall Astra H Mk5 Throttle Body 18 16V 192741726219
  1406. USB C OTG Cable Type C Male to 113257868779
  1407. 10LCD Digital Writing Drawing Tablet Pad Portable Electronic 113275292591
  1408. Carabiner D Ring Clip Snap Spring Hook Keyring Buckle 113326748568
  1409. Rear Lens Dust Cap Cover for Sony NEX 251750197219
  1410. 2011 Toyota Urbancruiser 14 D 4D AWD 5dr EU5 323329273222
  1411. 8x48W LED Work Light Headlight Driving Lamp SUV 273051499151
  1412. The Fighter DVD 2013 Mark Wahlberg Christian Bale 362503911322
  1413. Fashion Eyes Star Tassel Anklets for Women Ethnic 232945099523
  1414. Glow Plug Engine Diesel Pre Heater For Fiat Qubo 371729809513
  1415. Good pair of Yoruba Ibeji figures Male and 123507634622
  1416. OEM Suzuki Katana GSX600F 1988 1996 Rear Wheel Sprocket 362214845471
  1417. Hardcore Thunder Megamix Vol2 2cd Various Artists Audio 163437855198
  1418. formula 1 153303734479
  1419. Filters Side Brushes 12pcs Parts Replacement For ILIFE V3s 223293598542
  1420. Warhammer 40k Chaos Space Marines Cultists Leader w1193 401665649434
  1421. Gwen Stefani No Doubt Lamb Autograph Photo Authentic 233054950641
  1422. Toy Story 2 Special Edition Slip Cover Blu ray 192754885322
  1423. Peters and Lee hand signed autograph photo 272377057834
  1424. SATIN RIBBON 22m 25yards DOUBLE SIDED for Crafts Decoration 490730189737
  1425. Haibane Renmei Volume 1 DVD DVD 142404115382
  1426. Iridescent Foil 23cm Buffet Food Party Paper Plates 273377475713
  1427. VW VOLSWAGEN POLO 2010 2015 12 TSi PETROL ENGINE 232979810285
  1428. Kids Children Boys Girls Snowflakes Kids Baby Toddler 601811860571
  1429. Debussy The Complete Piano Works 0190295869199 352550999865
  1430. 12 Decks Ellusionist Bicycle Playing Cards Sealed Box 472012528731
  1431. New 8x10 World War II Photo American Cargo 132659235243
  1432. Official How to Train Your Dragon 2 Cast 420777890217
  1433. Latest 4 5 6 7 8 10 oz 391774778874
  1434. The Very Hungry Caterpillar A Pull Out Pop Up 312370896681
  1435. Peppa Pepper Pig Peppas Christmas Dvd 172801835395
  1436. 300Pcs Car Retainer Push Pin Rivet Fasteners Trim 282996140401
  1437. Enamel Badge NAL Bergensfjord Norwegian 123547849438
  1438. 2016 Renault Captur 15Dci K9K628 Egr Valve Cooler 263178992291
  1439. Fai Autoparts Bfs134S Rocker Tappet Rc892273P Oe 292343229086
  1440. Vespa 150 T Michelin City Grip Winter Rear 331879294125
  1441. 24 Cast Iron Shell Cup Pull Cabinet Cupboard 232919315951
  1442. 12Pcs Red Pretend Role Play Kitchen Toy Kids 163252400271
  1443. 2013 Royal Mail 480 489 491 M22 Year 332923239228
  1444. Bad Santa Naughty List Fun Christmas Fabric Quilting 162646864914
  1445. Baby Babies Toddler Girls Socks Pom Pom Grey 552318632559
  1446. Worth Kids Baby Colorful Wooden Mini Around Beads 202544393191
  1447. Womens Ladies Polo Shirt T Shirt Tee Short Sleeve 601057293785
  1448. Titleist Pro V1 Pro V1x PROV1x Golf Lake 521918622294
  1449. 1895 Victoria One Shilling Silver 173701959643
  1450. VOLTAGE REGULATOR DUCATI ENERGIA APRILIA Pegaso 125 1991 233050273530
  1451. Dear Santa Wall Sticker Wall Chick Decal Art 572888297860
  1452. World Cup Nigeria Soccer Ball All Over Mens 401538307134
  1453. Cylinder Works Big Bore Gasket Kit 3mm over 132842493699
  1454. House of Puzzles 1000 piece Jigsaw Puzzle 223292104558
  1455. Doc Martin Series 4 Complete DVD 302233770190
  1456. G9 E27 E14 Bright LED Corn Bulb Desk Lamp Cool Warm 502541811924
  1457. BIG BORE 70cc BARREL KIT SET HEAD for 323488727557
  1458. REDUCED Victoria Sterling 0925 Silver Godless Florin 283283503066
  1459. Laptop Car Charger for ASUS TRANSFORMER BOOK FLIP 113356199451
  1460. Soimoi Fabric Clover Leaves Floral Print Fabric by 441917478387
  1461. Starhide Mens Bifold Real Distressed Leather Wallet With 391895292222
  1462. subbuteo vintage team arsenal st patrick athletic 173702440703
  1463. Vintage Native American Crushed Turquoise Cuff Bangle Bracelet 173708055480
  1464. 69 9501TB KN TYPHOON COLD AIR KIT fits VW 292147875895
  1465. PAUL ANKA The Essential 1976 12 Vinyl DBL 254021030411
  1466. Usher Raymond genuine authentic signed 10x8 photo AFTAL 112826230400
  1467. 5 x 1 4 to 3 8 Spigot Stud Male 352440798598
  1468. Antique Cast Iron Book Press W N Sharpe 302991569359
  1469. M20 Truck Photos AEC John Laing 362514706996
  1470. JT Rear Sprocket 45T 530P High Carbon Steel 283269999283
  1471. 5PCS HSS Drill Bit Hole Saw Tooth Set 162877253302
  1472. Have I Got News For You Best 173691043243
  1473. Portable Vacuum Cleaner 5M Cable Truck Boat Super 163146059608
  1474. Tabbert Vivaldi 560 TD 250 2006 13 Tempest 263982001963
  1475. Qty 3 x 18M USB Extension Cable 264012346613
  1476. New Ebc Front And Rear Brake Discs And 263089781764
  1477. lenovo x201 thinkpad 121 inch screen refurbished 332597983287
  1478. Salon System Just Wax Creme Wax 253587790432
  1479. Women Summer Party Package Transparent Alphabet Jelly Bag 572858622089
  1480. Replacement Parts Shure SE215 SE425 SE535 SE846 SE315 441955826340
  1481. 1976 Pewter Mug Tankard With Glass Bottom 163430147186
  1482. Switch One 10 2 in 1 Laptop Intel Atom X5 Z8300 143060007483
  1483. F1 2016 Xbox One Formula 1 FREE UK 292816844587
  1484. ASH IRISH GROUP Meltdown CD Europe Infectious 2004 264095302059
  1485. Retro Sideboard Vintage Teak Effect Drinks Cabinet Dining 232952819320
  1486. Kaley Cuoco Elizabeth Perkins Hop Despicable Me DVD NEUF 172729179834
  1487. Scrubbing Sponges Scourer Double Sided Dish Cleaning Scouring 352528362926
  1488. Primark Harry Potter Limited Edition 3D Hagrid Face 292894518103
  1489. 100 Natural Ethiopian Welo Opal Cabochon Nice Fire 492600132960
  1490. YAMAHA MT 01 Oxford Stormex Waterproof Motorcycle Motorbike Bike 232996776249
  1491. Dark Matter Season 1 DVD Region 4 382646091425
  1492. Land Of The Dead UMD 2005 Directors Cut 382665957102
  1493. Nike Kaishi Kids Boys Girls Trainer Shoe Size 272786617454
  1494. Unusual Star Shape VINTAGE ART DECO 153299781537
  1495. Powerful Slingshot Catapult Ghost Head Sling Shot Outdoor 651426886774
  1496. The Beatles Rock Band ROCKBAND Xbox 360 Game 292859365892
  1497. 2015 American Silver Eagle NGC MS70 301501601118
  1498. Doors by GardIda CD condition very 163421561236
  1499. Mia MIA AIM New Vinyl 381872589946
  1500. With A Smile And A Song Walt Disneys 202527508506
  1501. Ultra Sparkly Chunky Glitter Fabric Vinyl Crafts Bow 412732453621
  1502. Vintage Retro Circle Sunglasses 70s 80s Oval Fashion 202245982997
  1503. Yves Saint Laurent MON PARIS Gift Set 30ml 173692465926
  1504. Ignition Coil for MERCEDES VANEO 16 19 M166 372139024221
  1505. 1 Pair Women Lady Crystal Rhinestone Dangle Gold 162110732143
  1506. Ultimate Smooth Jazz 1S Cd New Sealed Lebron 362504715980
  1507. Vintage oriental brown tunic 10 dress rare steempunk 143064318074
  1508. Fur Trimmed Scottish 100 Wool Red Royal Stewart 172069067708
  1509. 2x 635mm 1 4 Male to 35 mm Female 392086339195
  1510. Large Absorbent Microfibre Dish Drying Mat 41X46Cm Fast 441938753697
  1511. 2x 635mm 1 4 Male to 35 mm Female 401570158425
  1512. Mens Gents Black Designer Real Sheep Nappa Soft 581769694328
  1513. Honda Civic Se I Vtec 2008 5 Door N s 162302738692
  1514. 1Pc 635mm 1 4 Inch Male Plug to 2 263420812728
  1515. Mini Paper Cut Punch Scrapbook Card Craft Cutter 562456267816
  1516. Wooden Twisting Worm Caterpillar Toy Educational Gift for 202357546680
  1517. JACK WILLS Womens Hoodie Jumper 10 Red Oversized 254042954110
  1518. Tamiya maquette 86037 Peinture Bombe PS 37 Rouge Translucide 391777454344